KEGG   Homo sapiens (human): 10668
Entry
10668             CDS       T01001                                 
Symbol
CGRRF1, CGR19, RNF197
Name
(RefSeq) cell growth regulator with ring finger domain 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-C3HC4_3 Prok-RING_4
Other DBs
NCBI-GeneID: 10668
NCBI-ProteinID: NP_006559
OMIM: 606138
HGNC: 15528
Ensembl: ENSG00000100532
Pharos: Q99675(Tdark)
UniProt: Q99675
Structure
Position
14:54509906..54539292
AA seq 332 aa
MAAVFLVTLYEYSPLFYIAVVFTCFIVTTGLVLGWFGWDVPVILRNSEETQFSTRVFKKQ
MRQVKNPFGLEITNPSSASITTGITLTTDCLEDSLLTCYWGCSVQKLYEALQKHVYCFRI
STPQALEDALYSEYLYQEQYFIKKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLA
DEDDREIYDIISMVSVIHIPDRTYKLSCRILYQYLLLAQGQFHDLKQLFMSANNNFTPSN
NSSSEEKNTDRSLLEKVGLSESEVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVK
YFQQCPMCRQFVQESFALCSQKEQDKDKPKTL
NT seq 999 nt   +upstreamnt  +downstreamnt
atggctgcggtgtttctggtaacgctttatgaatactcgccgcttttctacatcgcggtg
gtctttacctgcttcatcgtgaccaccggcctggtattgggatggtttggttgggatgtt
ccagtaattctgagaaattcagaagagacccagttcagcacaagagttttcaaaaagcaa
atgagacaagtcaagaatccttttggcttagagatcactaatccatcttcagcttcaatt
acaactggcataaccttgacaacagattgccttgaagatagcctccttacatgctactgg
gggtgcagtgttcaaaaattatatgaagctctgcagaagcatgtttattgcttcagaata
agcactccccaagcattagaagatgctctgtatagtgaatatctctatcaggaacagtat
tttattaaaaaggatagcaaagaagaaatatattgccagttaccaagagatactaaaatt
gaagactttggtacagtacccagatctcgctatccattggtagcgctattgaccttagct
gatgaggatgaccgggaaatttatgatattatttccatggtgtcagtgattcatattcct
gataggacttataaactatcctgcagaatattgtatcaatatttactcttggctcaaggt
caatttcatgatcttaagcaacttttcatgtctgcaaataataatttcactccctccaac
aattcctcttcagaagaaaaaaacacagacagaagtttgttggaaaaggtgggactctct
gaaagtgaagttgagccatcggaagagaacagcaaggactgtgttgtttgccagaatggg
actgtgaactgggtactcttaccatgcagacacacatgcctgtgtgatggctgtgtgaag
tattttcagcagtgcccaatgtgcaggcagtttgttcaggaatcttttgcactttgcagt
caaaaagagcaagataaagacaaaccgaagactctttga

DBGET integrated database retrieval system