KEGG   Homo sapiens (human): 10670Help
Entry
10670             CDS       T01001                                 

Gene name
RRAGA, FIP-1, FIP1, RAGA
Definition
(RefSeq) Ras related GTP binding A
  KO
K16185  Ras-related GTP-binding protein A/B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    10670 (RRAGA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    10670 (RRAGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gtr1_RagA Ras Roc Arf MMR_HSR1 GTP_EFTU SRPRB DUF815 PduV-EutP ABC_tran SecA_DEAD AAA_24
Motif
Other DBs
NCBI-GeneID: 10670
NCBI-ProteinID: NP_006561
OMIM: 612194
HGNC: 16963
Ensembl: ENSG00000155876
Vega: OTTHUMG00000019621
Pharos: Q7L523(Tbio)
UniProt: Q7L523
Structure
PDB: 

Position
9p22.1
AA seq 313 aa AA seqDB search
MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNL
WDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDA
KIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQL
IPNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCKEQRDVHRFEKISNIIKQFKL
SCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKL
ERVDGPKHSLLMR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatacagccatgaagaaaaaggtgctgctgatggggaagagcgggtcggggaag
accagcatgaggtcgataatcttcgccaattacattgctcgcgacacccggcgcctgggg
gccaccattgacgtggaacactcccacgtccgattcctagggaacctggtgctgaacctg
tgggactgtggcggtcaggacaccttcatggaaaattacttcaccagccagcgagacaat
atcttccgtaacgtggaagttttgatttacgtgtttgacgtggagagccgcgaactggaa
aaggacatgcattattaccagtcgtgtctggaggccatcctccagaactctcctgacgcc
aaaatcttctgcctggtgcacaaaatggatctggttcaggaggatcagcgtgacctgatt
tttaaagagcgagaggaagacctgaggcgtctgtctcgcccgctggagtgtgcttgtttt
cgaacgtccatctgggatgagacgctctacaaagcctggtccagcatcgtctaccagctg
attcccaacgttcagcagctggagatgaacctcaggaattttgcccaaatcattgaggcc
gatgaagttctgctgttcgaaagagctacattcttggttatttcccactaccagtgcaaa
gagcagcgcgacgtccaccggtttgagaagatcagcaacatcatcaaacagttcaagctg
agctgcagtaaattggccgcttccttccagagcatggaagttaggaattccaacttcgct
gctttcatcgacatcttcacctcaaatacgtacgtgatggtggtcatgtcagatccgtcg
atcccttctgcggccactctgatcaacattcgcaatgcccggaaacactttgagaagctg
gagagagtggatggccccaagcacagtctccttatgcgttga

DBGET integrated database retrieval system