KEGG   Homo sapiens (human): 106707243Help
Entry
106707243         CDS       T01001                                 

Gene name
PRH1-TAS2R14
Definition
(RefSeq) PRH1-TAS2R14 readthrough
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TAS2R
Motif
Other DBs
NCBI-GeneID: 106707243
NCBI-ProteinID: NP_001303822
UniProt: Q6ZW62
Position
12p13.2
AA seq 176 aa AA seqDB search
MWRGIDSIYPYESWSLTLLSRLEFSGRIMAYCSLELLGSNHPPTSAFCCRRIFCLLEPAV
STQEWKFSQKMQHTVKISGDASTKAHRGVKSVITFFLLYAIFSLSFFISVWTSERLEENL
IILSQVMGMAYPSCHSCVLILGNKKLRQASLSVLLWLRYMFKDGEPSGHKEFRESS
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggggaatagactccatctatccatatgagagttggagtctcactctgttatcc
aggctggagttcagtggtaggatcatggcttactgcagtctggaactcctgggctcaaac
catcctcccacctcagccttctgctgcagaagaatattttgcctgctggaacctgctgta
tctactcaagagtggaagttttcacagaagatgcagcacactgtcaaaatatccggagac
gccagcaccaaagcccacagaggagttaaaagtgtgatcactttcttcctactctatgcc
attttctctctgtcttttttcatatcagtttggacctctgaaaggttggaggaaaatcta
attattctttcccaggtgatgggaatggcttatccttcatgtcactcatgtgttctgatt
cttggaaacaagaagctgagacaggcctctctgtcagtgctactgtggctgaggtacatg
ttcaaagatggggagccctcaggtcacaaagaatttagagaatcatcttga

DBGET integrated database retrieval system