KEGG   Homo sapiens (human): 10672
Entry
10672             CDS       T01001                                 

Gene name
GNA13, G13
Definition
(RefSeq) G protein subunit alpha 13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04611  Platelet activation
hsa04730  Long-term depression
hsa04810  Regulation of actin cytoskeleton
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05130  Pathogenic Escherichia coli infection
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00405  CXCR4-GNA12/13-Rho signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    10672 (GNA13)
   04072 Phospholipase D signaling pathway
    10672 (GNA13)
   04071 Sphingolipid signaling pathway
    10672 (GNA13)
   04022 cGMP-PKG signaling pathway
    10672 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10672 (GNA13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    10672 (GNA13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    10672 (GNA13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    10672 (GNA13)
  09156 Nervous system
   04730 Long-term depression
    10672 (GNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    10672 (GNA13)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10672 (GNA13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    10672 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10672 (GNA13)
   04031 GTP-binding proteins [BR:hsa04031]
    10672 (GNA13)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10672 (GNA13)
  Exosomal proteins of colorectal cancer cells
   10672 (GNA13)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    10672 (GNA13)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 10672
NCBI-ProteinID: NP_006563
OMIM: 604406
HGNC: 4381
Ensembl: ENSG00000120063
Vega: OTTHUMG00000179316
Pharos: Q14344(Tbio)
UniProt: Q14344 A0A024R8M0
Position
17q24.1
AA seq 377 aa
MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGD
KMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggacttcctgccgtcgcggtccgtgctgtccgtgtgcttccccggctgcctgctg
acgagtggcgaggccgagcagcaacgcaagtccaaggagatcgacaaatgcctgtctcgg
gaaaagacctatgtgaagcggctggtgaagatcctgctgctgggcgcgggcgagagcggc
aagtccaccttcctgaagcagatgcggatcatccacgggcaggacttcgaccagcgcgcg
cgcgaggagttccgccccaccatctacagcaacgtgatcaaaggtatgagggtgctggtt
gatgctcgagagaagcttcatattccctggggagacaactcaaaccaacaacatggagat
aagatgatgtcgtttgatacccgggcccccatggcagcccaaggaatggtggaaacaagg
gttttcttacaatatcttcctgctataagagcattatgggcagacagcggcatacagaat
gcctatgaccggcgtcgagaatttcaactgggtgaatctgtaaaatatttcctggataac
ttggataaacttggagaaccagattatattccatcacaacaagatattctgcttgccaga
agacccaccaaaggcatccatgaatacgactttgaaataaaaaatgttcctttcaaaatg
gttgatgtaggtggtcagagatcagaaaggaaacgttggtttgaatgtttcgacagtgtg
acatcaatacttttccttgtttcctcaagtgaatttgaccaggtgcttatggaagatcga
ctgaccaatcgccttacagagtctctgaacatttttgaaacaatcgtcaataaccgggtt
ttcagcaatgtctccataattctgttcttaaacaagacagacttgcttgaggagaaggtg
caaattgtgagcatcaaagactatttcctagaatttgaaggggatccccactgcttaaga
gacgtccaaaaattcctggtggaatgtttccggaacaaacgccgggaccagcaacagaag
cccttataccaccacttcaccactgctatcaacacggagaacatccgccttgttttccgt
gacgtgaaggatactattctgcatgacaacctcaagcagcttatgctacagtga

KEGG   Homo sapiens (human): 2768
Entry
2768              CDS       T01001                                 

Gene name
GNA12, NNX3, RMP, gep
Definition
(RefSeq) G protein subunit alpha 12
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04730  Long-term depression
hsa04810  Regulation of actin cytoskeleton
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05130  Pathogenic Escherichia coli infection
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00405  CXCR4-GNA12/13-Rho signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2768 (GNA12)
   04072 Phospholipase D signaling pathway
    2768 (GNA12)
   04071 Sphingolipid signaling pathway
    2768 (GNA12)
   04022 cGMP-PKG signaling pathway
    2768 (GNA12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2768 (GNA12)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    2768 (GNA12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    2768 (GNA12)
  09156 Nervous system
   04730 Long-term depression
    2768 (GNA12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2768 (GNA12)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    2768 (GNA12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    2768 (GNA12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2768 (GNA12)
   04031 GTP-binding proteins [BR:hsa04031]
    2768 (GNA12)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   2768 (GNA12)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    2768 (GNA12)
SSDB
Motif
Pfam: G-alpha Arf GTP_EFTU FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 2768
NCBI-ProteinID: NP_031379
OMIM: 604394
HGNC: 4380
Ensembl: ENSG00000146535
Vega: OTTHUMG00000023064
Pharos: Q03113(Tbio)
UniProt: Q03113 Q6ZQV4
Position
7p22.3-p22.2
AA seq 381 aa
MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDALLARERRAVRRLVKI
LLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQ
YSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVK
YFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQ
CFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDL
LVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVR
FVFHAVKDTILQENLKDIMLQ
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgtccggggtggtgcggaccctcagccgctgcctgctgccggccgaggccggcggggcc
cgcgagcgcagggcgggcagcggcgcgcgcgacgcggagcgcgaggcccggaggcgtagc
cgcgacatcgacgcgctgctggcccgcgagcggcgcgcggtccggcgcctggtgaagatc
ctgctgctgggcgcgggcgagagcggcaagtccacgttcctcaagcagatgcgcatcatc
cacggccgcgagttcgaccagaaggcgctgctggagttccgcgacaccatcttcgacaac
atcctcaagggctcaagggttcttgttgatgcacgagataagcttggcattccttggcag
tattctgaaaatgagaagcatgggatgttcctgatggccttcgagaacaaggcggggctg
cctgtggagccggccaccttccagctgtacgtcccggccctgagcgcactctggagggat
tctggcatcagggaggctttcagccggagaagcgagtttcagctgggggagtcggtgaag
tacttcctggacaacttggaccggatcggccagctgaattactttcctagtaagcaagat
atcctgctggctaggaaagccaccaagggaattgtggagcatgacttcgttattaagaag
atcccctttaagatggtggatgtgggcggccagcggtcccagcgccagaagtggttccag
tgcttcgacgggatcacgtccatcctgttcatggtctcctccagcgagtacgaccaggtc
ctcatggaggacaggcgcaccaaccggctggtggagtccatgaacatcttcgagaccatc
gtcaacaacaagctcttcttcaacgtctccatcattctcttcctcaacaagatggacctc
ctggtggagaaggtgaagaccgtgagcatcaagaagcacttcccggacttcaggggcgac
ccgcacaggctggaggacgtccagcgctacctggtccagtgcttcgacaggaagagacgg
aaccgcagcaagccactcttccaccacttcaccaccgccatcgacaccgagaacgtccgc
ttcgtgttccatgctgtgaaagacaccatcctgcaggagaacctgaaggacatcatgctg
cagtga

KEGG   Homo sapiens (human): 2770
Entry
2770              CDS       T01001                                 

Gene name
GNAI1, Gi
Definition
(RefSeq) G protein subunit alpha i1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04360  Axon guidance
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa04971  Gastric acid secretion
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05133  Pertussis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06167  Human cytomegalovirus (HCMV)
nt06310  CRH-ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00430  CXCR4-GNAI-PI3K-BAD signaling pathway
N00431  HIV gp120 to CXCR4-GNAI-PI3K-BAD signaling pathway
N00879  PROK-PRKR-Gi-ERK signaling pathway
N00880  Mutation-inactivated PROK2 to PROK-PRKR-Gi-ERK signaling pathway
N00881  Mutation-inactivated PROKR2 to PROK-PRKR-Gi-ERK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2770 (GNAI1)
   04371 Apelin signaling pathway
    2770 (GNAI1)
   04071 Sphingolipid signaling pathway
    2770 (GNAI1)
   04024 cAMP signaling pathway
    2770 (GNAI1)
   04022 cGMP-PKG signaling pathway
    2770 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    2770 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2770 (GNAI1)
   04670 Leukocyte transendothelial migration
    2770 (GNAI1)
   04062 Chemokine signaling pathway
    2770 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    2770 (GNAI1)
   04915 Estrogen signaling pathway
    2770 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    2770 (GNAI1)
   04921 Oxytocin signaling pathway
    2770 (GNAI1)
   04926 Relaxin signaling pathway
    2770 (GNAI1)
   04935 Growth hormone synthesis, secretion and action
    2770 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    2770 (GNAI1)
   04916 Melanogenesis
    2770 (GNAI1)
   04924 Renin secretion
    2770 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    2770 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    2770 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    2770 (GNAI1)
   04727 GABAergic synapse
    2770 (GNAI1)
   04725 Cholinergic synapse
    2770 (GNAI1)
   04728 Dopaminergic synapse
    2770 (GNAI1)
   04726 Serotonergic synapse
    2770 (GNAI1)
   04730 Long-term depression
    2770 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    2770 (GNAI1)
  09158 Development and regeneration
   04360 Axon guidance
    2770 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2770 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2770 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    2770 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    2770 (GNAI1)
   05032 Morphine addiction
    2770 (GNAI1)
   05034 Alcoholism
    2770 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    2770 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    2770 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    2770 (GNAI1)
   05163 Human cytomegalovirus infection
    2770 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    2770 (GNAI1)
   05142 Chagas disease (American trypanosomiasis)
    2770 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2770 (GNAI1)
   04031 GTP-binding proteins [BR:hsa04031]
    2770 (GNAI1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2770 (GNAI1)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    2770 (GNAI1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 2770
NCBI-ProteinID: NP_002060
OMIM: 139310
HGNC: 4384
Ensembl: ENSG00000127955
Vega: OTTHUMG00000023523
Pharos: P63096(Tbio)
UniProt: P63096
Structure
PDB: 

Position
7q21.11
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgctgagcgccgaggacaaggcggcggtggagcggagtaagatgatcgac
cgcaacctccgtgaggacggcgagaaggcggcgcgcgaggtcaagctgctgctgctcggt
gctggtgaatctggtaaaagtacaattgtgaagcagatgaaaattatccatgaagctggt
tattcagaagaggagtgtaaacaatacaaagcagtggtctacagtaacaccatccagtca
attattgctatcattagggctatggggaggttgaagatagactttggtgactcagcccgg
gcggatgatgcacgccaactctttgtgctagctggagctgctgaagaaggctttatgact
gcagaacttgctggagttataaagagattgtggaaagatagtggtgtacaagcctgtttc
aacagatcccgagagtaccagcttaatgattctgcagcatactatttgaatgacttggac
agaatagctcaaccaaattacatcccgactcaacaagatgttctcagaactagagtgaaa
actacaggaattgttgaaacccattttactttcaaagatcttcattttaaaatgtttgat
gtgggaggtcagagatctgagcggaagaagtggattcattgcttcgaaggagtgacggcg
atcatcttctgtgtagcactgagtgactacgacctggttctagctgaagatgaagaaatg
aaccgaatgcatgaaagcatgaaattgtttgacagcatatgtaacaacaagtggtttaca
gatacatccattatactttttctaaacaagaaggatctctttgaagaaaaaatcaaaaag
agccctctcactatatgctatccagaatatgcaggatcaaacacatatgaagaggcagct
gcatatattcaatgtcagtttgaagacctcaataaaagaaaggacacaaaggaaatatac
acccacttcacatgtgccacagatactaagaatgtgcagtttgtttttgatgctgtaaca
gatgtcatcataaaaaataatctaaaagattgtggtctcttttaa

KEGG   Homo sapiens (human): 2771
Entry
2771              CDS       T01001                                 

Gene name
GNAI2, GIP, GNAI2B, H_LUCA15.1, H_LUCA16.1
Definition
(RefSeq) G protein subunit alpha i2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04360  Axon guidance
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa04971  Gastric acid secretion
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05133  Pertussis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06167  Human cytomegalovirus (HCMV)
nt06310  CRH-ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00430  CXCR4-GNAI-PI3K-BAD signaling pathway
N00431  HIV gp120 to CXCR4-GNAI-PI3K-BAD signaling pathway
N00879  PROK-PRKR-Gi-ERK signaling pathway
N00880  Mutation-inactivated PROK2 to PROK-PRKR-Gi-ERK signaling pathway
N00881  Mutation-inactivated PROKR2 to PROK-PRKR-Gi-ERK signaling pathway
Disease
H00033  Adrenal carcinoma
H02269  Familial ventricular tachycardia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2771 (GNAI2)
   04371 Apelin signaling pathway
    2771 (GNAI2)
   04071 Sphingolipid signaling pathway
    2771 (GNAI2)
   04024 cAMP signaling pathway
    2771 (GNAI2)
   04022 cGMP-PKG signaling pathway
    2771 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    2771 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2771 (GNAI2)
   04670 Leukocyte transendothelial migration
    2771 (GNAI2)
   04062 Chemokine signaling pathway
    2771 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    2771 (GNAI2)
   04915 Estrogen signaling pathway
    2771 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    2771 (GNAI2)
   04921 Oxytocin signaling pathway
    2771 (GNAI2)
   04926 Relaxin signaling pathway
    2771 (GNAI2)
   04935 Growth hormone synthesis, secretion and action
    2771 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    2771 (GNAI2)
   04916 Melanogenesis
    2771 (GNAI2)
   04924 Renin secretion
    2771 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    2771 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    2771 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    2771 (GNAI2)
   04727 GABAergic synapse
    2771 (GNAI2)
   04725 Cholinergic synapse
    2771 (GNAI2)
   04728 Dopaminergic synapse
    2771 (GNAI2)
   04726 Serotonergic synapse
    2771 (GNAI2)
   04730 Long-term depression
    2771 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    2771 (GNAI2)
  09158 Development and regeneration
   04360 Axon guidance
    2771 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2771 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2771 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    2771 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    2771 (GNAI2)
   05032 Morphine addiction
    2771 (GNAI2)
   05034 Alcoholism
    2771 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    2771 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    2771 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    2771 (GNAI2)
   05163 Human cytomegalovirus infection
    2771 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    2771 (GNAI2)
   05142 Chagas disease (American trypanosomiasis)
    2771 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2771 (GNAI2)
   04031 GTP-binding proteins [BR:hsa04031]
    2771 (GNAI2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2771 (GNAI2)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    2771 (GNAI2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29
Other DBs
NCBI-GeneID: 2771
NCBI-ProteinID: NP_002061
OMIM: 139360
HGNC: 4385
Ensembl: ENSG00000114353
Vega: OTTHUMG00000156940
Pharos: P04899(Tbio)
UniProt: P04899 B3KP24
Structure
PDB: 
6D9H

Position
3p21.31
AA seq 355 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggctgcaccgtgagcgccgaggacaaggcggcggccgagcgctctaagatgatcgac
aagaacctgcgggaggacggagagaaggcggcgcgggaggtgaagttgctgctgttgggt
gctggggagtcagggaagagcaccatcgtcaagcagatgaagatcatccacgaggatggc
tactccgaggaggaatgccggcagtaccgggcggttgtctacagcaacaccatccagtcc
atcatggccattgtcaaagccatgggcaacctgcagatcgactttgccgacccctccaga
gcggacgacgccaggcagctatttgcactgtcctgcaccgccgaggagcaaggcgtgctc
cctgatgacctgtccggcgtcatccggaggctctgggctgaccatggtgtgcaggcctgc
tttggccgctcaagggaataccagctcaacgactcagctgcctactacctgaacgacctg
gagcgtattgcacagagtgactacatccccacacagcaagatgtgctacggacccgcgta
aagaccacggggatcgtggagacacacttcaccttcaaggacctacacttcaagatgttt
gatgtgggtggtcagcggtctgagcggaagaagtggatccactgctttgagggcgtcaca
gccatcatcttctgcgtagccttgagcgcctatgacttggtgctagctgaggacgaggag
atgaaccgcatgcatgagagcatgaagctattcgatagcatctgcaacaacaagtggttc
acagacacgtccatcatcctcttcctcaacaagaaggacctgtttgaggagaagatcaca
cacagtcccctgaccatctgcttccctgagtacacaggggccaacaaatatgatgaggca
gccagctacatccagagtaagtttgaggacctgaataagcgcaaagacaccaaggagatc
tacacgcacttcacgtgcgccaccgacaccaagaacgtgcagttcgtgtttgacgccgtc
accgatgtcatcatcaagaacaacctgaaggactgcggcctcttctga

KEGG   Homo sapiens (human): 2773
Entry
2773              CDS       T01001                                 

Gene name
GNAI3, 87U6, ARCND1
Definition
(RefSeq) G protein subunit alpha i3
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04360  Axon guidance
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa04971  Gastric acid secretion
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05133  Pertussis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06167  Human cytomegalovirus (HCMV)
nt06310  CRH-ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00430  CXCR4-GNAI-PI3K-BAD signaling pathway
N00431  HIV gp120 to CXCR4-GNAI-PI3K-BAD signaling pathway
N00879  PROK-PRKR-Gi-ERK signaling pathway
N00880  Mutation-inactivated PROK2 to PROK-PRKR-Gi-ERK signaling pathway
N00881  Mutation-inactivated PROKR2 to PROK-PRKR-Gi-ERK signaling pathway
Disease
H01884  Auriculocondylar syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2773 (GNAI3)
   04371 Apelin signaling pathway
    2773 (GNAI3)
   04071 Sphingolipid signaling pathway
    2773 (GNAI3)
   04024 cAMP signaling pathway
    2773 (GNAI3)
   04022 cGMP-PKG signaling pathway
    2773 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    2773 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2773 (GNAI3)
   04670 Leukocyte transendothelial migration
    2773 (GNAI3)
   04062 Chemokine signaling pathway
    2773 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    2773 (GNAI3)
   04915 Estrogen signaling pathway
    2773 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    2773 (GNAI3)
   04921 Oxytocin signaling pathway
    2773 (GNAI3)
   04926 Relaxin signaling pathway
    2773 (GNAI3)
   04935 Growth hormone synthesis, secretion and action
    2773 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    2773 (GNAI3)
   04916 Melanogenesis
    2773 (GNAI3)
   04924 Renin secretion
    2773 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    2773 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    2773 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    2773 (GNAI3)
   04727 GABAergic synapse
    2773 (GNAI3)
   04725 Cholinergic synapse
    2773 (GNAI3)
   04728 Dopaminergic synapse
    2773 (GNAI3)
   04726 Serotonergic synapse
    2773 (GNAI3)
   04730 Long-term depression
    2773 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    2773 (GNAI3)
  09158 Development and regeneration
   04360 Axon guidance
    2773 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2773 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2773 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    2773 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    2773 (GNAI3)
   05032 Morphine addiction
    2773 (GNAI3)
   05034 Alcoholism
    2773 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    2773 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    2773 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    2773 (GNAI3)
   05163 Human cytomegalovirus infection
    2773 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    2773 (GNAI3)
   05142 Chagas disease (American trypanosomiasis)
    2773 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2773 (GNAI3)
   04031 GTP-binding proteins [BR:hsa04031]
    2773 (GNAI3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2773 (GNAI3)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    2773 (GNAI3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 2773
NCBI-ProteinID: NP_006487
OMIM: 139370
HGNC: 4387
Ensembl: ENSG00000065135
Vega: OTTHUMG00000189112
Pharos: P08754(Tbio)
UniProt: P08754
Structure
PDB: 

Position
1p13.3
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaagacaaggcggcagtggagcgaagcaagatgatcgac
cgcaacttacgggaggacggggaaaaagcggccaaagaagtgaagctgctgctactcggt
gctggagaatctggtaaaagcaccattgtgaaacagatgaaaatcattcatgaggatggc
tattcagaggatgaatgtaaacaatataaagtagttgtctacagcaatactatacagtcc
atcattgcaatcataagagccatgggacggctaaagattgactttggggaagctgccagg
gcagatgatgcccggcaattatttgttttagctggcagtgctgaagaaggagtcatgact
ccagaactagcaggagtgattaaacggttatggcgagatggtggggtacaagcttgcttc
agcagatccagggaatatcagctcaatgattctgcttcatattatctaaatgatctggat
agaatatcccagtctaactacattccaactcagcaagatgttcttcggacgagagtgaag
accacaggcattgtagaaacacatttcaccttcaaagacctatacttcaagatgtttgat
gtaggtggccaaagatcagaacgaaaaaagtggattcactgttttgagggagtgacagca
attatcttctgtgtggccctcagtgattatgaccttgttctggctgaggacgaggagatg
aaccgaatgcatgaaagcatgaaactgtttgacagcatttgtaataacaaatggtttaca
gaaacttcaatcattctcttccttaacaagaaagacctttttgaggaaaaaataaagagg
agtccgttaactatctgttatccagaatacacaggttccaatacatatgaagaggcagct
gcctatattcaatgccagtttgaagatctgaacagaagaaaagataccaaggagatctat
actcacttcacctgtgccacagacacgaagaatgtgcagtttgtttttgatgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtggactttattga

KEGG   Homo sapiens (human): 2775
Entry
2775              CDS       T01001                                 

Gene name
GNAO1, EIEE17, G-ALPHA-o, GNAO, HLA-DQB1, NEDIM
Definition
(RefSeq) G protein subunit alpha o1
  KO
K04534  guanine nucleotide-binding protein G(o) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06124  Chemokine signaling (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
Disease
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2775 (GNAO1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    2775 (GNAO1)
   04921 Oxytocin signaling pathway
    2775 (GNAO1)
   04926 Relaxin signaling pathway
    2775 (GNAO1)
   04916 Melanogenesis
    2775 (GNAO1)
  09156 Nervous system
   04724 Glutamatergic synapse
    2775 (GNAO1)
   04727 GABAergic synapse
    2775 (GNAO1)
   04725 Cholinergic synapse
    2775 (GNAO1)
   04728 Dopaminergic synapse
    2775 (GNAO1)
   04726 Serotonergic synapse
    2775 (GNAO1)
   04730 Long-term depression
    2775 (GNAO1)
   04723 Retrograde endocannabinoid signaling
    2775 (GNAO1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2775 (GNAO1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2775 (GNAO1)
   05034 Alcoholism
    2775 (GNAO1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    2775 (GNAO1)
   05163 Human cytomegalovirus infection
    2775 (GNAO1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    2775 (GNAO1)
   05142 Chagas disease (American trypanosomiasis)
    2775 (GNAO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2775 (GNAO1)
   04031 GTP-binding proteins [BR:hsa04031]
    2775 (GNAO1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2775 (GNAO1)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    2775 (GNAO1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB DUF685 AAA_29 AAA_24
Other DBs
NCBI-GeneID: 2775
NCBI-ProteinID: NP_066268
OMIM: 139311
HGNC: 4389
Ensembl: ENSG00000087258
Vega: OTTHUMG00000133241
Pharos: P09471(Tbio)
UniProt: P09471 B3KP89 Q8N6I9
Structure
PDB: 
6FUF 6OIK 6G79

Position
16q13
AA seq 354 aa
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
SAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDA
AAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggatgtactctgagcgcagaggagagagccgccctcgagcggagcaaggcgattgag
aaaaacctcaaagaggatggcatcagcgccgccaaagacgtgaaattactcctgctcggg
gctggagaatcaggaaaaagcaccattgtgaagcagatgaagatcatccatgaagatggc
ttctccggagaagacgtgaaacagtacaagcctgttgtctacagcaacactatccagtcc
ctggcagccatcgtccgggccatggacactttgggcatcgaatatggtgataaggagaga
aaggctgacgccaagatggtgtgtgatgtggtgagtcggatggaagacaccgagcccttc
tctgcagagctgctttctgccatgatgcggctctggggcgactcaggaatccaagagtgc
ttcaaccggtcccgggagtatcagctcaacgactctgccaaatactacctggacagcctg
gatcggattggggccgccgactaccagcccaccgagcaggacatcctccgaaccagggtc
aaaaccactggcatcgtagaaacccacttcacattcaagaacctccacttcaggctgttt
gacgtcggaggccagcgatctgaacgcaagaagtggatccattgcttcgaggacgtcacg
gccatcattttctgtgtcgcgctcagcggctatgaccaggtgctccacgaagacgaaacc
acgaaccgcatgcacgagtctctcatgctcttcgactccatctgtaacaacaagttcttc
atcgatacctccatcattctcttcctcaacaagaaagatctctttggcgagaagatcaag
aagtcacctttgaccatctgctttcctgaatacacaggccccaatacctatgaagacgca
gccgcctacatccaagcacaatttgaaagcaaaaaccgctcacccaacaaagaaatatat
tgtcacatgacttgtgccacagacacgaataacatccaggtggtgttcgacgccgtcacc
gacatcatcattgccaacaacctccggggctgcggcttgtactga

KEGG   Homo sapiens (human): 2778
Entry
2778              CDS       T01001                                 

Gene name
GNAS, AHO, C20orf45, GNAS1, GPSA, GSA, GSP, NESP, PITA3, POH, SCG6, SgVI
Definition
(RefSeq) GNAS complex locus
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04962  Vasopressin-regulated water reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05110  Vibrio cholerae infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06124  Chemokine signaling (viruses)
nt06167  Human cytomegalovirus (HCMV)
nt06310  CRH-ACTH-cortisol signaling
nt06318  CaSR-PTH signaling
nt06322  TRH-TSH-TH signaling
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
nt06324  GHRH-GH-IGF signaling
nt06326  AVP signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00289  Mutation-inactivated GNAS to PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00299  Mutation-inactivated MC2R to ACTH-cortisol signaling pathway
N00300  Mutation-inactivated MRAP to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00785  Mutation-inactivated PAX8 to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
N00885  LHCGR-GNAS-PKA signaling pathway
N00886  Mutation-activated LHCGR to LHCGR-GNAS-PKA signaling pathway
N00910  GHRHR-PKA-GH signaling pathway
N00911  Mutation-inactivated GHRHR to GHRHR-PKA-GH signaling pathway
N00912  Mutation-activated GNAS to GHRHR-PKA-GH signaling pathway
N00915  AVP-V2R-PKA signaling pathway
N00916  Mutation-inactivated AVP to AVP-V2R-PKA signaling pathway
N00917  Mutation-activated AVPR2 to AVP-V2R-PKA signaling pathway
N00922  FSHR-GNAS-PKA signaling pathway
N00923  Mutation-inactivated FSHB to FSHR-GNAS-PKA signaling pathway
Disease
H00244  Pseudohypoparathyroidism
H00441  Progressive osseous heteroplasia
H00501  Fibrous dysplasia, polyostotic
H01102  Pituitary adenomas
H01431  Cushing syndrome
H01483  Acromegaly
H02049  Bilateral macronodular adrenal hyperplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2778 (GNAS)
   04020 Calcium signaling pathway
    2778 (GNAS)
   04072 Phospholipase D signaling pathway
    2778 (GNAS)
   04024 cAMP signaling pathway
    2778 (GNAS)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    2778 (GNAS)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2778 (GNAS)
  09152 Endocrine system
   04911 Insulin secretion
    2778 (GNAS)
   04922 Glucagon signaling pathway
    2778 (GNAS)
   04923 Regulation of lipolysis in adipocytes
    2778 (GNAS)
   04912 GnRH signaling pathway
    2778 (GNAS)
   04913 Ovarian steroidogenesis
    2778 (GNAS)
   04915 Estrogen signaling pathway
    2778 (GNAS)
   04921 Oxytocin signaling pathway
    2778 (GNAS)
   04926 Relaxin signaling pathway
    2778 (GNAS)
   04935 Growth hormone synthesis, secretion and action
    2778 (GNAS)
   04918 Thyroid hormone synthesis
    2778 (GNAS)
   04928 Parathyroid hormone synthesis, secretion and action
    2778 (GNAS)
   04916 Melanogenesis
    2778 (GNAS)
   04924 Renin secretion
    2778 (GNAS)
   04925 Aldosterone synthesis and secretion
    2778 (GNAS)
   04927 Cortisol synthesis and secretion
    2778 (GNAS)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    2778 (GNAS)
   04270 Vascular smooth muscle contraction
    2778 (GNAS)
  09154 Digestive system
   04970 Salivary secretion
    2778 (GNAS)
   04971 Gastric acid secretion
    2778 (GNAS)
   04972 Pancreatic secretion
    2778 (GNAS)
   04976 Bile secretion
    2778 (GNAS)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    2778 (GNAS)
   04961 Endocrine and other factor-regulated calcium reabsorption
    2778 (GNAS)
  09156 Nervous system
   04724 Glutamatergic synapse
    2778 (GNAS)
   04728 Dopaminergic synapse
    2778 (GNAS)
   04726 Serotonergic synapse
    2778 (GNAS)
   04730 Long-term depression
    2778 (GNAS)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    2778 (GNAS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2778 (GNAS)
   04714 Thermogenesis
    2778 (GNAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2778 (GNAS)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    2778 (GNAS)
  09165 Substance dependence
   05030 Cocaine addiction
    2778 (GNAS)
   05031 Amphetamine addiction
    2778 (GNAS)
   05032 Morphine addiction
    2778 (GNAS)
   05034 Alcoholism
    2778 (GNAS)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    2778 (GNAS)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    2778 (GNAS)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    2778 (GNAS)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    2778 (GNAS)
   05165 Human papillomavirus infection
    2778 (GNAS)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    2778 (GNAS)
   05142 Chagas disease (American trypanosomiasis)
    2778 (GNAS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    2778 (GNAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2778 (GNAS)
   04031 GTP-binding proteins [BR:hsa04031]
    2778 (GNAS)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2778 (GNAS)
  Exosomal proteins of other body fluids (saliva and urine)
   2778 (GNAS)
  Exosomal proteins of colorectal cancer cells
   2778 (GNAS)
  Exosomal proteins of bladder cancer cells
   2778 (GNAS)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    2778 (GNAS)
SSDB
Motif
Pfam: G-alpha Arf Roc Gtr1_RagA GTP_EFTU AAA_29 TniB
Other DBs
NCBI-GeneID: 2778
NCBI-ProteinID: NP_000507
OMIM: 139320
HGNC: 4392
Ensembl: ENSG00000087460
Vega: OTTHUMG00000033069
Pharos: O95467(Tbio) P63092(Tbio)
UniProt: P63092 O95467 A0A0S2Z3H8
Structure
PDB: 

Position
20q13.32
AA seq 394 aa
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQM
RILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELA
NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLD
KIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFND
VTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEK
VLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY
PHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgggctgcctcgggaacagtaagaccgaggaccagcgcaacgaggagaaggcgcagcgt
gaggccaacaaaaagatcgagaagcagctgcagaaggacaagcaggtctaccgggccacg
caccgcctgctgctgctgggtgctggagaatctggtaaaagcaccattgtgaagcagatg
aggatcctgcatgttaatgggtttaatggagagggcggcgaagaggacccgcaggctgca
aggagcaacagcgatggtgagaaggcaaccaaagtgcaggacatcaaaaacaacctgaaa
gaggcgattgaaaccattgtggccgccatgagcaacctggtgccccccgtggagctggcc
aaccccgagaaccagttcagagtggactacatcctgagtgtgatgaacgtgcctgacttt
gacttccctcccgaattctatgagcatgccaaggctctgtgggaggatgaaggagtgcgt
gcctgctacgaacgctccaacgagtaccagctgattgactgtgcccagtacttcctggac
aagatcgacgtgatcaagcaggctgactatgtgccgagcgatcaggacctgcttcgctgc
cgtgtcctgacttctggaatctttgagaccaagttccaggtggacaaagtcaacttccac
atgtttgacgtgggtggccagcgcgatgaacgccgcaagtggatccagtgcttcaacgat
gtgactgccatcatcttcgtggtggccagcagcagctacaacatggtcatccgggaggac
aaccagaccaaccgcctgcaggaggctctgaacctcttcaagagcatctggaacaacaga
tggctgcgcaccatctctgtgatcctgttcctcaacaagcaagatctgctcgctgagaaa
gtccttgctgggaaatcgaagattgaggactactttccagaatttgctcgctacactact
cctgaggatgctactcccgagcccggagaggacccacgcgtgacccgggccaagtacttc
attcgagatgagtttctgaggatcagcactgccagtggagatgggcgtcactactgctac
cctcatttcacctgcgctgtggacactgagaacatccgccgtgtgttcaacgactgccgt
gacatcattcagcgcatgcaccttcgtcagtacgagctgctctaa

KEGG   Homo sapiens (human): 2781
Entry
2781              CDS       T01001                                 

Gene name
GNAZ, gz-alpha
Definition
(RefSeq) G protein subunit alpha z
  KO
K04535  guanine nucleotide-binding protein G(z) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04730  Long-term depression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    2781 (GNAZ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    2781 (GNAZ)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    2781 (GNAZ)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29 AAA_16
Other DBs
NCBI-GeneID: 2781
NCBI-ProteinID: NP_002064
OMIM: 139160
HGNC: 4395
Ensembl: ENSG00000128266
Vega: OTTHUMG00000150611
Pharos: P19086(Tbio)
UniProt: P19086 Q8IY73
Position
22q11.22-q11.23
AA seq 355 aa
MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGG
FNLEACKEYKPLIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEI
TPELLGVMRRLWADPGAQACFSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRD
MTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQ
TSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLAEKIRRIPLTICFPEYKGQNTYEEA
AVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLKYIGLC
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggatgtcggcaaagctcagaggaaaaagaagcagcccggcggtcccggagaattgac
cgccacctgcgctcagagagccagcggcaacgccgcgaaatcaagctgctcctgctgggc
accagcaactcaggcaagagcaccatcgtcaaacagatgaagatcatccacagcggcggc
ttcaacctggaggcctgcaaggagtacaagcccctcatcatctacaatgccatcgactcg
ctgacccgcatcatccgggccctggccgccctcaggatcgacttccacaaccccgaccgc
gcctacgacgctgtgcagctctttgcgctgacgggccccgctgagagcaagggcgagatc
acacccgagctgctgggtgtcatgcgacggctctgggccgacccaggggcacaggcctgc
ttcagccgctccagcgagtaccacctggaggacaacgcggcctactacctgaacgacctg
gagcgcatcgccgcagctgactatatccccactgtcgaggacatcctgcgctcccgggac
atgaccacgggcattgtggagaacaagttcaccttcaaggagctcaccttcaagatggtg
gacgtgggggggcagaggtcagagcgcaaaaagtggatccactgcttcgagggcgtcaca
gccatcatcttctgtgtggagctcagcggctacgacctgaaactctacgaggataaccag
acaagtcggatggcagagagcttgcgcctctttgactccatctgcaacaacaactggttc
atcaacacctcactcatcctcttcctgaacaagaaggacctgctggcagagaagatccgc
cgcatcccgctcaccatctgctttcccgagtacaagggccagaacacgtacgaggaggcc
gctgtctacatccagcggcagtttgaagacctgaaccgcaacaaggagaccaaggagatc
tactcccacttcacctgcgccaccgacaccagtaacatccagtttgtcttcgacgcggtg
acagacgtcatcatacagaacaatctcaagtacattggcctttgctga

DBGET integrated database retrieval system