KEGG   Homo sapiens (human): 10675Help
Entry
10675             CDS       T01001                                 

Gene name
CSPG5, NGC
Definition
(RefSeq) chondroitin sulfate proteoglycan 5
  KO
K08116  chondroitin sulfate proteoglycan 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    10675 (CSPG5)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Others
   10675 (CSPG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chon_Sulph_att Neural_ProG_Cyt
Motif
Other DBs
NCBI-GeneID: 10675
NCBI-ProteinID: NP_001193872
OMIM: 606775
HGNC: 2467
Ensembl: ENSG00000114646
Vega: OTTHUMG00000133518
Pharos: O95196(Tbio)
UniProt: O95196
Position
3p21.31
AA seq 566 aa AA seqDB search
MGRAGGGGPGRGPPPLLLFLGAALVLASGAVPAREAGSAVEAEELVKGSPAWEPPANDTR
EEAGPPAAGEDEASWTAPGGELAGPEEVLQESAAVTGTAWLEADSPGLGGVTAEAGSGDA
QALPATLQAPHEVLGQSIMPPAIPEATEASGPPSPTPGDKLSPASELPKESPLEVWLNLG
GSTPDPQGPELTYPFQGTLEPQPASDIIDIDYFEGLDGEGRGADLGSFPGSPGTSENHPD
TEGETPSWSLLDLYDDFTPFDESDFYPTTSFYDDLDEEEEEEEDDKDAVGGGDLEDENEL
LVPTGKPGLGPGTGQPTSRWHAVPPQHTLGSVPGSSIALRPRPGEPGRDLASSENGTECR
SGFVRHNGSCRSVCDLFPSYCHNGGQCYLVENIGAFCRCNTQDYIWHKGMRCESIITDFQ
VMCVAVGSAALVLLLLFMMTVFFAKKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIA
EGSHPNVRKLCNTPRTSSPHARALAHYDNVICQDDPSAPHKIQEVLKSCLKEEESFNIQN
SMSPKLEGGKGDQADLDVNCLQNNLT
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggggcgagccgggggcgggggcccgggccgggggccgccgccactgctgctgtttctg
ggggccgcgctggtcctggcctctggggccgtgccggcgcgtgaggcgggcagcgcggtt
gaggccgaagagctggtgaagggcagcccggcgtgggagccgcctgccaacgacacgcgg
gaagaagccggcccaccagcggctggggaagatgaggcgtcgtggacggcgcccggtggc
gagctggccgggccagaagaggtgctgcaggagtcggctgcggtgaccggcaccgcctgg
ctggaagctgacagcccaggcctgggaggagtgaccgcagaggcgggcagcggcgatgcc
caggcccttccagctacgctccaggctccccacgaggtcctcgggcagtcaatcatgccc
cctgccattcctgaggctacagaggccagcgggccaccctcccccacccccggcgacaag
ctgagcccagcttctgaactccccaaggagagccccttggaggtttggctgaacctgggg
ggcagcacacccgaccctcaagggccagagctgacttacccatttcagggcaccctggag
ccccaaccggcatcagatatcattgacatcgactacttcgaaggactggatggtgagggt
cgtggcgcagatctggggagcttcccagggtcaccaggaacctcagagaaccaccctgat
actgagggagagaccccttcctggagcctgcttgacttatacgatgatttcacccccttc
gatgaatctgatttctaccccaccacatccttttatgatgacttggatgaagaggaggag
gaagaggaggatgacaaagatgcagtaggaggtggagacctagaagatgaaaatgagctt
ctagtgcccactgggaagcctggtctggggcccgggacaggccagcccaccagtcggtgg
catgctgtccctccacagcacactctggggtcggtccccggcagcagcatcgccctcagg
ccccgcccaggagagccaggcagggacttggcctccagtgaaaatggcactgagtgccgc
agtggctttgtgcggcataacggctcctgccggtcagtgtgcgacctcttcccaagttac
tgtcacaatggcggccagtgctacctggtggagaacataggggccttctgcaggtgcaac
acgcaggactacatctggcacaaggggatgcgctgcgagtccatcatcaccgacttccag
gtgatgtgcgtggccgtgggctcggctgccctcgtcctgctcctgctcttcatgatgacg
gtgttctttgccaagaagctctacctgctcaagacggagaataccaagctgcgtaggacc
aacaaattccggaccccatctgagctccacaatgataacttctccctctccaccattgcc
gagggctctcacccaaatgtaaggaaactttgcaacactccccgtacctcctccccccat
gcccgtgccttggctcactatgataacgttatctgtcaggatgatcctagtgctccccac
aaaatccaggaggttctcaagtcctgcctgaaagaggaggagtcatttaacatccagaac
tccatgtcgcccaaacttgagggtggcaaaggtgaccaggctgacttggatgtgaactgt
cttcagaataatttaacctaa

DBGET integrated database retrieval system