KEGG   Homo sapiens (human): 1068Help
Entry
1068              CDS       T01001                                 

Gene name
CETN1, CEN1, CETN
Definition
(RefSeq) centrin 1
  KO
K16465  centrin-1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1068 (CETN1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    1068 (CETN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_9 EF-hand_5 EF-hand_4 Dockerin_1 EF-hand_14 SurA_N_3 SUB1_ProdP9 LETM1 Gp-FAR-1
Motif
Other DBs
NCBI-GeneID: 1068
NCBI-ProteinID: NP_004057
OMIM: 603187
HGNC: 1866
Ensembl: ENSG00000177143
Vega: OTTHUMG00000131471
Pharos: Q12798(Tbio)
UniProt: Q12798 A0A140VJG3
Position
18p11.32
AA seq 172 aa AA seqDB search
MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRAL
GFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGK
ISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcttccggcttcaagaagcccagcgctgcctccaccggccaaaagagaaaggtggca
cctaagcccgagctcactgaggatcagaagcaagaagttcgggaagcatttgacctcttc
gacgtggacggaagtgggaccatcgacgcgaaggagctgaaggtggccatgagagcgctg
ggcttcgaacccaggaaggaagagatgaagaaaatgatctccgaggtggacagggaaggc
acggggaagatcagcttcaatgacttcctggccgtgatgacgcagaagatgtccgagaag
gacaccaaagaagaaatcctgaaggccttcaggctctttgatgacgatgagaccgggaag
atctcgttcaaaaacctgaagcgtgtggccaacgagctgggggagaacctcacggatgag
gagctgcaggagatgatcgacgaagctgatcgggatggggacggcgaagtgaacgaggag
gagttccttcggatcatgaagaagaccagcctttactga

DBGET integrated database retrieval system