KEGG   Homo sapiens (human): 10681Help
Entry
10681             CDS       T01001                                 

Gene name
GNB5, GB5, IDDCA, LADCI
Definition
(RefSeq) G protein subunit beta 5
  KO
K04539  guanine nucleotide-binding protein subunit beta-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04062  Chemokine signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04371  Apelin signaling pathway
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04926  Relaxin signaling pathway
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
Network
N00152  CXCR-GNB/G-ERK signaling pathway
N00153  CXCR-GNB/G-PI3K-JNK signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
N00158  KSHV vGPCR to GNB/G-PI3K-AKT signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00206  KSHV vGPCR to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    10681 (GNB5)
   04371 Apelin signaling pathway
    10681 (GNB5)
   04151 PI3K-Akt signaling pathway
    10681 (GNB5)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    10681 (GNB5)
  Endocrine system
   04926 Relaxin signaling pathway
    10681 (GNB5)
  Nervous system
   04724 Glutamatergic synapse
    10681 (GNB5)
   04727 GABAergic synapse
    10681 (GNB5)
   04725 Cholinergic synapse
    10681 (GNB5)
   04728 Dopaminergic synapse
    10681 (GNB5)
   04726 Serotonergic synapse
    10681 (GNB5)
   04723 Retrograde endocannabinoid signaling
    10681 (GNB5)
  Environmental adaptation
   04713 Circadian entrainment
    10681 (GNB5)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10681 (GNB5)
  Substance dependence
   05032 Morphine addiction
    10681 (GNB5)
   05034 Alcoholism
    10681 (GNB5)
  Infectious diseases
   05163 Human cytomegalovirus infection
    10681 (GNB5)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    10681 (GNB5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10681 (GNB5)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    10681 (GNB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like Atg14
Motif
Other DBs
NCBI-GeneID: 10681
NCBI-ProteinID: NP_057278
OMIM: 604447
HGNC: 4401
Ensembl: ENSG00000069966
Vega: OTTHUMG00000131892
Pharos: O14775(Tbio)
UniProt: O14775 A0A024R5V3
Position
15q21.2
AA seq 395 aa AA seqDB search
MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSE
AESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRI
VSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDK
NENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADV
LCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGS
DDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRV
SILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatcagacctttctcgttaatgtatttggctcatgtgacaaatgtttcaaacaa
cgagctctgagaccagttttcaagaagtctcaacaactcagctactgttcaacatgtgca
gaaattatggcaaccgaggggctgcacgagaacgagacgctggcgtcgctgaagagcgag
gccgagagcctcaagggcaagctggaggaggagcgagccaagctgcacgatgtggagctg
caccaggtggcggagcgggtggaggccctggggcagtttgtcatgaagaccagaaggacc
ctcaaaggccacgggaacaaagtcctgtgcatggactggtgcaaagataagaggaggatc
gtgagctcgtcacaggatgggaaggtgatcgtgtgggattccttcaccacaaacaaggag
cacgcggtcaccatgccctgcacgtgggtgatggcatgtgcttatgccccatcgggatgt
gccattgcttgtggtggtttggataataagtgttctgtgtaccccttgacgtttgacaaa
aatgaaaacatggctgccaaaaagaagtctgttgctatgcacaccaactacctgtcggcc
tgcagcttcaccaactctgacatgcagatcctgacagcgagcggcgatggcacatgtgcc
ctgtgggacgtggagagcgggcagctgctgcagagcttccacggacatggggctgacgtc
ctctgcttggacctggccccctcagaaactggaaacaccttcgtgtctgggggatgtgac
aagaaagccatggtgtgggacatgcgctccggccagtgcgtgcaggcctttgaaacacat
gaatctgacatcaacagtgtccggtactaccccagtggagatgcctttgcttcagggtca
gatgacgctacgtgtcgcctctatgacctgcgggcagatagggaggttgccatctattcc
aaagaaagcatcatatttggagcatccagcgtggacttctccctcagtggtcgcctgctg
tttgctggatacaatgattacactatcaacgtctgggatgttctcaaagggtcccgggtc
tccatcctgtttggacatgaaaaccgcgttagcactctacgagtttcccccgatgggact
gctttctgctctggatcatgggatcataccctcagagtctgggcctaa

DBGET integrated database retrieval system