KEGG   Homo sapiens (human): 1069Help
Entry
1069              CDS       T01001                                 

Gene name
CETN2, CALT, CEN2
Definition
(RefSeq) centrin 2
  KO
K10840  centrin-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    1069 (CETN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1069 (CETN2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    1069 (CETN2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    1069 (CETN2)
   Centrosome duplication proteins
    Centriole replication proteins
     1069 (CETN2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      1069 (CETN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_9 EF-hand_5 EF-hand_14 EF-hand_4 SPARC_Ca_bdg SurA_N_3 DUF853 Sigma54_CBD SurA_N_2 SUB1_ProdP9 Dockerin_1 Nmad4 DUF4601 LETM1
Motif
Other DBs
NCBI-GeneID: 1069
NCBI-ProteinID: NP_004335
OMIM: 300006
HGNC: 1867
Ensembl: ENSG00000147400
Vega: OTTHUMG00000024246
Pharos: P41208(Tbio)
UniProt: P41208
Structure
PDB: 

Position
Xq28
AA seq 172 aa AA seqDB search
MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRAL
GFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGK
ISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaactttaagaaggcaaacatggcatcaagttctcagcgaaaaagaatgagc
cctaagcctgagcttactgaagagcaaaagcaggagatccgggaagcttttgatcttttc
gatgcggatggaactggcaccatagatgttaaagaactgaaggtggcaatgagggccctg
ggctttgaacccaagaaagaagaaattaagaaaatgataagtgaaattgataaggaaggg
acaggaaaaatgaactttggtgactttttaactgtgatgacccagaaaatgtctgagaaa
gatactaaagaagaaatcctgaaagctttcaagctctttgatgatgatgaaactgggaag
atttcgttcaaaaatctgaaacgcgtggccaaggagttgggtgagaacctgactgatgag
gagctgcaggaaatgattgatgaagctgatcgagatggagatggagaggtcagtgagcaa
gagttcctgcgcatcatgaaaaagaccagcctctattaa

DBGET integrated database retrieval system