KEGG   Homo sapiens (human): 10691
Entry
10691             CDS       T01001                                 

Gene name
GMEB1, P96PIF, PIF96
Definition
(RefSeq) glucocorticoid modulatory element binding protein 1
  KO
K24505  glucocorticoid modulatory element-binding protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10691 (GMEB1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   SAND domain-containing proteins
    10691 (GMEB1)
SSDB
Motif
Pfam: SAND DFF-C
Other DBs
NCBI-GeneID: 10691
NCBI-ProteinID: NP_006573
OMIM: 604409
HGNC: 4370
Ensembl: ENSG00000162419
Vega: OTTHUMG00000003647
Pharos: Q9Y692(Tbio)
UniProt: Q9Y692 B2RCN8
Structure
PDB: 
1OQJ

Position
1p35.3
AA seq 573 aa
MANAEVSVPVGDVVVVPTEGNEGENPEDTKTQVILQLQPVQQGLFIDGHFYNRIYEAGSE
NNTAVVAVETHTIHKIEEGIDTGTIEANEDMEIAYPITCGESKAILLWKKFVCPGINVKC
VKFNDQLISPKHFVHLAGKSTLKDWKRAIRLGGIMLRKMMDSGQIDFYQHDKVCSNTCRS
TKFDLLISSARAPVPGQQTSVVQTPTSADGSITQIAISEESMEEAGLEWNSALTAAVTMA
TEEGVKKDSEEISEDTLMFWKGIADVGLMEEVVCNIQKEIEELLRGVQQRLIQAPFQVTD
AAVLNNVAHTFGLMDTVKKVLDNRRNQVEQGEEQFLYTLTDLERQLEEQKKQGQDHRLKS
QTVQNVVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMG
NIPVATLSQGSSPVTVHTLPSGPQLFRYATVVSSAKSSSPDTVTIHPSSSLALLSSTAMQ
DGSTLGNMTTMVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAV
ILETELRTEEKVVAEMEEHQHQVHNVEIVVLED
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggctaatgcagaagtgagtgtcccagtgggggatgtggttgtggtacctactgaagga
aatgaaggggagaatcctgaagacactaaaacccaagtgattttgcagttacagcctgtg
caacaaggtttgtttatcgatggacacttttacaacaggatttatgaagctgggtcggag
aacaacacggcagttgtagcagtagaaactcacacgatacacaaaattgaagaagggatt
gatacaggcactatagaagcaaatgaggatatggaaattgcttaccccataacttgtggg
gagagcaaagccatcctcctctggaagaagtttgtatgtccaggaataaacgtgaagtgt
gtcaagttcaatgatcagttgatcagccccaagcactttgttcatctggctggcaagtcc
actctgaaggactggaagagagctattcgtctgggtgggatcatgctcaggaaaatgatg
gactccggacagattgatttttaccaacatgacaaagtttgctccaatacctgcagaagc
accaaatttgatcttctgatcagcagtgcaagagctccagtgccaggacagcagacaagt
gtggtgcagacacccacttcggctgatggtagcatcacgcagattgccatctcagaagag
agcatggaagaggcagggctggaatggaactcagctctcaccgctgctgtcaccatggcc
acggaggagggtgtaaagaaagactcagaggaaatttcagaggacactttgatgttctgg
aaaggaatagctgatgtagggctgatggaagaggttgtctgcaatatacagaaggaaata
gaggagctactcaggggagttcagcagcggctcatccaggctcccttccaagtcacagat
gctgctgttctcaacaatgtagcacacacatttggcctaatggacacagtcaagaaggtt
ttagacaacagaaggaaccaagtagagcagggagaagaacagtttctctatactctgaca
gacttggaacgccagttggaggagcagaagaagcaaggccaggatcacaggctgaaatct
cagacagttcaaaatgtggtactgatgcctgtgagcactcctaagcctccaaaaaggccc
cggctccagcggccagcctccaccactgtcttgagcccttctcctcctgtccagcagcct
cagttcacagtcatctcacccatcaccatcaccccagtgggtcagtcattttccatgggc
aatattccagtggccaccctcagccagggctccagtcctgtgactgtccacacactgcct
tctggccctcagctcttccgctatgccacagtggtctcctctgccaagagcagctcacca
gacacagtgaccatccacccttcatctagcttggcgctgctgagctctactgccatgcag
gatgggagtacactgggcaacatgaccaccatggttagccctgtggaattggtggccatg
gagtccggcctaacctcggcaattcaggctgttgaaagcacctcagaggatgggcagacc
atcattgagattgatccagccccggacccagaagctgaagatactgagggcaaagcagtc
atcttggagacagagctgaggactgaggagaaagttgtggctgagatggaagaacaccag
catcaagttcacaatgtggagattgtggtcttagaggattaa

DBGET integrated database retrieval system