KEGG   Homo sapiens (human): 10692Help
Entry
10692             CDS       T01001                                 

Gene name
RRH
Definition
(RefSeq) retinal pigment epithelium-derived rhodopsin homolog
  KO
K04253  visual pigment-like receptor peropsin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    10692 (RRH)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Vision
   Opsin
    10692 (RRH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srt 7TM_GPCR_Srx 7tm_4 MIF4G
Motif
Other DBs
NCBI-GeneID: 10692
NCBI-ProteinID: NP_006574
OMIM: 605224
HGNC: 10450
Ensembl: ENSG00000180245
Vega: OTTHUMG00000132045
Pharos: O14718(Tbio)
UniProt: O14718
Position
4q25
AA seq 337 aa AA seqDB search
MLRNNLGNSSDSKNEDGSVFSQTEHNIVATYLIMAGMISIISNIIVLGIFIKYKELRTPT
NAIIINLAVTDIGVSSIGYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVA
VDRYLTICLPDVGRRMTTNTYIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWR
KNDRSFVSYTMTVIAINFIVPLTVMFYCYYHVTLSIKHHTTSDCTESLNRDWSDQIDVTK
MSVIMICMFLVAWSPYSIVCLWASFGDPKKIPPPMAIIAPLFAKSSTFYNPCIYVVANKK
FRRAMLAMFKCQTHQTMPVTSILPMDVSQNPLASGRI
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgctaagaaataatttaggcaacagttcagactctaaaaatgaagatggctcggtcttt
tcacagactgaacacaatattgttgcaacttacttgattatggcaggtatgataagtatt
atcagcaacataatagttctgggcatcttcattaagtacaaggaacttcggacacccaca
aatgcaattattattaacctggctgttactgatataggggtcagtagcattggctatccc
atgtctgctgcctcagatctgtatggaagttggaaatttggatacgcaggctgtcaggtt
tatgctggattgaatattttttttggaatggcaagcattggattactcacggtcgtggct
gtggaccgatacctgaccatctgccttcctgacgtagggagaagaatgaccaccaacact
tacatcggcttgattctgggagcctggatcaatggcctgttttgggctttgatgcctatc
atagggtgggctagttatgccccagatcctactggtgctacgtgtaccataaactggagg
aaaaatgatagatcttttgtgtcttacaccatgacagttattgcgataaattttattgtg
cccttgacagtgatgttttactgctattaccatgtcacgctatccattaaacatcacact
accagtgactgcactgagtccctcaacagagactggtcagatcagatagatgtaacaaag
atgtctgtgatcatgatctgcatgtttctggtggcatggtccccttattccatcgtgtgc
ttatgggcttcttttggtgacccaaagaagattcctccccccatggccatcatagctcca
ctgtttgcaaaatcttctacattctataacccctgcatttatgtggttgctaataaaaag
tttcggagggcaatgcttgccatgttcaaatgtcagactcaccaaacaatgcctgtgaca
agtattttacccatggatgtatctcaaaacccattggcttctggaagaatctga

DBGET integrated database retrieval system