KEGG   Homo sapiens (human): 10694Help
Entry
10694             CDS       T01001                                 

Gene name
CCT8, C21orf112, Cctq, D21S246, PRED71
Definition
(RefSeq) chaperonin containing TCP1 subunit 8
  KO
K09500  T-complex protein 1 subunit theta
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10694 (CCT8)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10694 (CCT8)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   10694 (CCT8)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    10694 (CCT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cpn60_TCP1 DUF2095
Motif
Other DBs
NCBI-GeneID: 10694
NCBI-ProteinID: NP_006576
OMIM: 617786
HGNC: 1623
Ensembl: ENSG00000156261
Vega: OTTHUMG00000044595
Pharos: P50990(Tbio)
UniProt: P50990
Position
21q21.3
AA seq 548 aa AA seqDB search
MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHL
EKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLR
IGLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEVFLA
KLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIA
VYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADM
ALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQV
VVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELA
KQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGL
DIEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
DWDDDQND
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttcacgttcccaaggctccgggctttgcccagatgctcaaggagggagcgaaa
cacttttcaggattagaagaggctgtgtatagaaacatacaagcttgcaaggagcttgcc
caaaccactcgtacagcatatggaccaaatggaatgaacaaaatggttatcaaccacttg
gagaagttgtttgtgacaaacgatgcagcaactattttaagagaactagaagtacagcat
cctgctgcaaaaatgattgtaatggcttctcatatgcaagagcaagaagttggagatggc
acaaactttgttctggtatttgctggagctctcctggaattagctgaagaacttctgagg
attggcctgtcagtttcagaggtcatagaaggttatgaaatagcctgcagaaaagctcat
gagattcttcctaatttggtatgttgttctgcaaaaaaccttcgagatattgatgaagtc
tcatctctacttcgtacctccataatgagtaaacaatatggtaatgaagtatttctggcc
aagcttattgctcaggcatgcgtatctatttttcctgattccggccatttcaatgttgat
aacatcagagtttgtaaaattctgggctctggtatcagttcctcttcagtattgcatggc
atggtttttaagaaggaaaccgaaggtgatgtaacatctgtcaaagatgcaaaaatagca
gtgtactcttgtccttttgatggcatgataacagaaactaagggaacagtgttgataaag
actgctgaagaattgatgaattttagtaagggagaagaaaacctcatggatgcacaagtc
aaagctattgctgatactggtgcaaatgtcgtagtaacaggtggcaaagtggcagacatg
gctcttcattatgcaaataaatataatatcatgttagtgaggctaaactcaaaatgggat
ctccgaagactttgtaaaactgttggtgctacagctcttcctagattgacacctcctgtc
cttgaagaaatgggacactgtgacagtgtttacctctcagaagttggagatactcaggtg
gtggtttttaagcatgaaaaggaagatggcgccatttctaccatagtacttcgaggctct
acagacaatctgatggatgacatagaaagggcagtagacgatggtgttaatactttcaaa
gttcttacaagggataaacgtcttgtacccggaggtggagcaacagaaattgaattagcc
aaacagatcacatcatatggagagacatgtcctggacttgaacagtatgctattaagaag
tttgctgaggcatttgaagctattccccgcgcactggcagaaaactctggagttaaggcc
aatgaagtaatctctaaactttatgcagtacatcaagaaggaaataaaaacgttggatta
gatattgaggctgaagtccctgctgtaaaggacatgctggaagctggtattctagatact
tacctgggaaaatattgggctatcaaactcgctactaatgctgcagtcactgtacttaga
gtggatcagatcatcatggcaaaaccagctggtgggcccaagcctccaagtgggaagaaa
gactgggatgatgaccaaaatgattga

DBGET integrated database retrieval system