KEGG   Homo sapiens (human): 107080638Help
Entry
107080638         CDS       T01001                                 

Definition
(RefSeq) TBC1D7-LOC100130357 readthrough
  KO
K20396  TBC1 domain family member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    107080638
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    107080638
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    107080638
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RabGAP-TBC DrrA_P4M
Motif
Other DBs
NCBI-GeneID: 107080638
NCBI-ProteinID: NP_001305738
Ensembl: ENSG00000145979
Vega: OTTHUMG00000014272
UniProt: Q9P0N9 A0A024QZX0
Structure
PDB: 

Position
6p24.1
AA seq 293 aa AA seqDB search
MTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALVW
KVLLGILPPHHESHAKVMMYRKEQYLDVLHALKVVRFVSDATPQAEVYLRMYQLESGKLP
RSPSFPLEPDDEVFLAIAKAMEEMVEDSVDCYWITRRFVNQLNTKYRDSLPQLPKAFEQY
LNLEDGRLLTHLRMCSAAPKLPYDLWFKRCFAGCLPESSLQRVWDKVVSGSCKILVFVAV
EILLTFKIKVMALNSAEKITKFLENIPQDSSDAIVSKAIDLWHKHCGTPVHSS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggactctcagagaaactttcgttcagtatattatgagaaagtggggtttcgt
ggagttgaagaaaagaaatcattagaaattctcctaaaagatgaccgtctggatactgag
aaactttgtacttttagtcagaggttccctctcccgtccatgtaccgtgcattggtatgg
aaggtgcttctaggaatcttgcctccacaccacgagtcccatgccaaggtgatgatgtat
cgtaaggagcagtacttggatgtccttcatgccctgaaagtcgttcgctttgttagtgat
gccacacctcaggctgaagtctatctccgcatgtatcagctggagtctgggaagttacct
cgaagtccctcttttccactggagccagatgatgaagtgtttcttgccatagctaaagcc
atggaggaaatggtggaagatagtgtcgactgttactggatcacccgacgctttgtgaac
caattaaataccaagtaccgggattccttgccccagttgccaaaagcgtttgaacaatac
ttgaatctggaagatggcagactgctgactcatctgaggatgtgttccgcggcgcccaaa
cttccttatgatctctggttcaagaggtgctttgcgggatgtttgcctgaatccagttta
cagagggtttgggataaagttgtgagtggatcctgtaagatcctagtttttgtagctgtc
gaaattttattaacctttaaaataaaagttatggcactgaacagtgcagagaagataaca
aagtttctggaaaatattccccaggacagctcagacgcgatcgtgagcaaggccattgac
ttgtggcacaaacactgtgggaccccggtccattcaagctga

KEGG   Homo sapiens (human): 51256Help
Entry
51256             CDS       T01001                                 

Gene name
TBC1D7, MGCPH, PIG51, TBC7
Definition
(RefSeq) TBC1 domain family member 7
  KO
K20396  TBC1 domain family member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    51256 (TBC1D7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51256 (TBC1D7)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    51256 (TBC1D7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RabGAP-TBC DrrA_P4M
Motif
Other DBs
NCBI-GeneID: 51256
NCBI-ProteinID: NP_001137436
OMIM: 612655
HGNC: 21066
Ensembl: ENSG00000145979
Vega: OTTHUMG00000014272
Pharos: Q9P0N9(Tbio)
UniProt: Q9P0N9 A0A024QZX0
Structure
PDB: 

Position
6p24.1
AA seq 293 aa AA seqDB search
MTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALVW
KVLLGILPPHHESHAKVMMYRKEQYLDVLHALKVVRFVSDATPQAEVYLRMYQLESGKLP
RSPSFPLEPDDEVFLAIAKAMEEMVEDSVDCYWITRRFVNQLNTKYRDSLPQLPKAFEQY
LNLEDGRLLTHLRMCSAAPKLPYDLWFKRCFAGCLPESSLQRVWDKVVSGSCKILVFVAV
EILLTFKIKVMALNSAEKITKFLENIPQDSSDAIVSKAIDLWHKHCGTPVHSS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggactctcagagaaactttcgttcagtatattatgagaaagtggggtttcgt
ggagttgaagaaaagaaatcattagaaattctcctaaaagatgaccgtctggatactgag
aaactttgtacttttagtcagaggttccctctcccgtccatgtaccgtgcattggtatgg
aaggtgcttctaggaatcttgcctccacaccacgagtcccatgccaaggtgatgatgtat
cgtaaggagcagtacttggatgtccttcatgccctgaaagtcgttcgctttgttagtgat
gccacacctcaggctgaagtctatctccgcatgtatcagctggagtctgggaagttacct
cgaagtccctcttttccactggagccagatgatgaagtgtttcttgccatagctaaagcc
atggaggaaatggtggaagatagtgtcgactgttactggatcacccgacgctttgtgaac
caattaaataccaagtaccgggattccttgccccagttgccaaaagcgtttgaacaatac
ttgaatctggaagatggcagactgctgactcatctgaggatgtgttccgcggcgcccaaa
cttccttatgatctctggttcaagaggtgctttgcgggatgtttgcctgaatccagttta
cagagggtttgggataaagttgtgagtggatcctgtaagatcctagtttttgtagctgtc
gaaattttattaacctttaaaataaaagttatggcactgaacagtgcagagaagataaca
aagtttctggaaaatattccccaggacagctcagacgcgatcgtgagcaaggccattgac
ttgtggcacaaacactgtgggaccccggtccattcaagctga

DBGET integrated database retrieval system