KEGG   Homo sapiens (human): 10713Help
Entry
10713             CDS       T01001                                 

Gene name
USP39, 65K, CGI-21, HSPC332, SAD1, SNRNP65
Definition
(RefSeq) ubiquitin specific peptidase 39
  KO
K12847  U4/U6.U5 tri-snRNP-associated protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10713 (USP39)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10713 (USP39)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP specific factors
    10713 (USP39)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH zf-UBP UCH_1
Motif
Other DBs
NCBI-GeneID: 10713
NCBI-ProteinID: NP_001243654
OMIM: 611594
HGNC: 20071
Ensembl: ENSG00000168883
Vega: OTTHUMG00000153090
Pharos: Q53GS9(Tbio)
UniProt: Q53GS9
Structure
PDB: 

Position
2p11.2
AA seq 565 aa AA seqDB search
MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAR
EAPASVVPFVRVKREREVDEDSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDF
EKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFSHHVFLNLHTLKFYCLPDNYE
IIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVL
QALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEML
QAVVLCSKKTFQITKQGDGVDFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKL
PHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILA
KFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDL
REYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQ
MITLSEAYIQIWKRRDNDETNQQGA
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtccggccggtctaagcgggagtctcgcggttccactcgcgggaagcgagagtctgag
tcgcggggcagctccggtcgcgtcaagcgggagcgagatcgggagcgggagcctgaggcg
gcgagctcccggggcagccctgtgcgcgtgaagcgggagttcgagccggcgagcgcgcgc
gaggccccggcttctgttgtcccgtttgtgcgggtgaagcgggagcgcgaggtcgatgag
gactcggagcctgagcgggaggtgcgagcaaagaatggccgagtggattctgaggaccgg
aggagccgccactgcccgtacctggacaccattaacaggagtgtgctggactttgacttt
gagaaactgtgttctatctccctctcacacatcaatgcttatgcctgtctggtgtgtggc
aagtactttcaaggccggggtttgaagtctcacgcctacattcacagtgtccagtttagc
caccatgttttcctcaacctccacaccctcaagttttactgccttccagacaactatgag
atcatcgattcctcattggaggatatcacgtatgtgttgaagcccactttcacaaagcag
caaattgcaaacttggacaagcaagccaaattgtcccgggcatatgatggtaccacttac
ctgccgggtattgtgggactgaataacataaaggccaatgattatgccaacgctgtcctt
caggctctatctaatgttcctcctctccggaactactttctggaagaagacaattataag
aacatcaaacgtcctccaggggatatcatgttcttgttggtccagcgttttggagagctg
atgagaaagctctggaaccctcgaaatttcaaggcacatgtgtctccccatgagatgctt
caggcagttgtactttgcagtaagaagacttttcagatcaccaaacaaggagatggcgtt
gactttctgtcttggtttctgaatgctctgcactcagctctggggggcacaaagaagaaa
aagaagactattgtgactgatgttttccaggggtccatgaggatcttcactaaaaagctt
ccccatcctgatctgccagcagaagaaaaagagcagttgctccataatgacgagtaccag
gagacaatggtggagtccacttttatgtacctgacgctggaccttcctactgcccccctc
tacaaggacgagaaggagcagctcatcattccccaagtgccactcttcaacatcctggct
aagttcaatggcatcactgagaaggaatataagacttacaaggagaactttctgaagcgc
ttccagcttaccaagttgcctccatatctaatcttttgtatcaagagattcactaagaac
aacttctttgttgagaagaatccaactattgtcaatttccctattacaaatgtggatctg
agagaatacttgtctgaagaagtacaagcagtacacaagaataccacctatgacctcatt
gccaacatcgtgcatgacggcaagccctccgagggctcctaccggatccacgtgcttcat
catgggacaggcaaatggtatgaattacaagacctccaggtgactgacatccttccccag
atgatcacactgtcagaggcttacattcagatttggaagaggcgagataatgatgaaacc
aaccagcagggggcttga

DBGET integrated database retrieval system