KEGG   Homo sapiens (human): 10714
Entry
10714             CDS       T01001                                 

Symbol
POLD3, P66, P68, PPP1R128
Name
(RefSeq) DNA polymerase delta 3, accessory subunit
  KO
K03504  DNA polymerase delta subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03410  Base excision repair
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
hsa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    10714 (POLD3)
   03410 Base excision repair
    10714 (POLD3)
   03420 Nucleotide excision repair
    10714 (POLD3)
   03430 Mismatch repair
    10714 (POLD3)
   03440 Homologous recombination
    10714 (POLD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    10714 (POLD3)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    10714 (POLD3)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    10714 (POLD3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10714 (POLD3)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    10714 (POLD3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      10714 (POLD3)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     10714 (POLD3)
SSDB
Motif
Pfam: CDC27
Other DBs
NCBI-GeneID: 10714
NCBI-ProteinID: NP_006582
OMIM: 611415
HGNC: 20932
Ensembl: ENSG00000077514
Vega: OTTHUMG00000165621
Pharos: Q15054(Tbio)
UniProt: Q15054 A0A024R5M8
Structure
PDB: 
3E0J

Position
11q13.4
AA seq 466 aa
MADQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVT
YLVSGSLIQNGHSCHKVAVVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYD
ILKSNLQNCSKFSAIQCAAAVPRAPAESSSSSKKFEQSHLHMSSETQANNELTTNGHGPP
ASKQVSQQPKGIMGMFASKAAAKTQETNKETKTEAKEVTNASAAGNKAPGKGNMMSNFFG
KAAMNKFKVNLDSEQAVKEEKIVEQPTVSVTEPKLATPAGLKKSSKKAEPVKVLQKEKKR
GKRVALSDDETKETENMRKKRRRIKLPESDSSEDEVFPDSPGAYEAESPSPPPPPSPPLE
PVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVTEKVYESESCTDSEEELNMK
TSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFFQRK
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggcggaccagctttatctggaaaatatagacgagttcgtcacggaccaaaacaagatc
gtgacatacaaatggctgagctatacactaggggttcatgttaaccaggccaaacagatg
ctgtatgattatgttgaaaggaaacgaaaagaaaattcaggagcccaactgcatgttacc
tacttggtgtctggcagtctcattcagaatggacattcctgccacaaggttgcagtagtg
agagaagataaattggaagcagtgaagtccaagctagctgtgactgccagcatccatgtg
tacagcatccagaaagccatgctaaaggacagtgggcctctgttcaatactgactatgac
atccttaaaagcaacttgcagaactgcagcaaatttagtgctatacaatgtgcagctgcc
gtccctagagctcctgctgaatcctcttcgtcttccaaaaagtttgagcagtcacatctt
cacatgtcaagtgagacacaagccaacaatgagctgaccaccaatggtcatggcccacct
gcatccaagcaggtttcccagcagcccaaaggaattatgggaatgtttgcctccaaagct
gctgctaaaacccaagaaaccaacaaggaaacgaaaacagaggctaaagaagtaacaaat
gcatctgcagcaggcaacaaggcaccagggaaagggaatatgatgagcaacttttttgga
aaagctgctatgaataaatttaaagtcaatttggactcagaacaagcagtgaaagaagaa
aaaatagtggagcagcctacagtgtctgtcacggaaccaaagctggcaactcctgcaggc
ctgaaaaaatccagcaaaaaagcagagcctgttaaggtgctgcagaaggaaaaaaaaagg
gggaagcgagtagcattatctgatgatgagacaaaggaaactgaaaacatgaggaaaaag
aggagaagaatcaaacttcctgaatctgatagcagtgaagatgaagtctttccagactct
cctggggcttatgaagctgagtcaccatccccacctcctcctccgtctccacctcttgaa
ccagtgccaaagactgagcctgaacctccttctgtcaagagctcaagtggagaaaacaaa
agaaaacgaaaacgcgtactaaaatctaaaacttacctggatggggaaggctgcatagtg
actgaaaaagtctacgagagtgaatcctgcacagatagtgaagaggagcttaacatgaag
acatcctcagtacacagaccccctgccatgactgtgaaaaaagaacccagagaggaacga
aagggccccaagaaagggactgctgctctgggcaaagccaacagacaggtgtccattact
ggcttcttccagaggaaataa

DBGET integrated database retrieval system