KEGG   Homo sapiens (human): 10715Help
Entry
10715             CDS       T01001                                 

Gene name
CERS1, EPM8, GDF-1, GDF1, LAG1, LASS1, UOG1
Definition
(RefSeq) ceramide synthase 1
  KO
K04710  ceramide synthetase [EC:2.3.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Disease
H00810  Progressive myoclonic epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    10715 (CERS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    10715 (CERS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     10715 (CERS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 10715
NCBI-ProteinID: NP_067090
OMIM: 606919
HGNC: 14253
Ensembl: ENSG00000223802
Vega: OTTHUMG00000183049
Pharos: P27544(Tbio)
UniProt: P27544
Position
19p13.11
AA seq 350 aa AA seqDB search
MAAAGPAAGPTGPEPMPSYAQLVQRGWGSALAAARGCTDCGWGLARRGLAEHAHLAPPEL
LLLALGALGWTALRSAATARLFRPLAKRCCLQPRDAAKMPESAWKFLFYLGSWSYSAYLL
FGTDYPFFHDPPSVFYDWTPGMAVPRDIAAAYLLQGSFYGHSIYATLYMDTWRKDSVVML
LHHVVTLILIVSSYAFRYHNVGILVLFLHDISDVQLEFTKLNIYFKSRGGSYHRLHALAA
DLGCLSFGFSWFWFRLYWFPLKVLYATSHCSLRTVPDIPFYFFFNALLLLLTLMNLYWFL
YIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggggcccgcggcggggccgacggggcccgagcccatgccgagctacgcg
cagctagtgcagcgcggctggggcagcgcgctggcggcggcgcggggctgcacggactgc
ggctgggggctggcgcgtcgcggcctggctgagcacgcgcacctggcgccgcccgagctg
ctgctgctggcgctcggcgcgctgggctggaccgccctgcgctccgcggccactgcgcgc
ctctttcggcccctggcgaagcggtgctgcctccagcccagagatgccgccaagatgccc
gagagcgcttggaagtttctcttctacctgggcagctggagctacagtgcctacctgctg
tttggcaccgactaccccttcttccatgacccaccatctgtcttctacgactggacgccg
ggcatggcagtgccacgggacattgcagccgcctacctgctccagggaagcttctatggc
cactccatctacgctacgctatacatggacacctggcgcaaggactcggtggtcatgctg
ctccaccacgtggtcactctcatcctcatcgtctcctcctacgccttccggtaccacaat
gtgggcatccttgtgctcttcctgcacgatatcagtgacgtgcagcttgagttcaccaag
ctcaacatttacttcaagtcccgcggcggctcctaccatcggctgcatgccttggcagca
gacttgggctgcctcagcttcggcttcagctggttctggttccgcctctactggttcccg
ctcaaggtcctgtatgccaccagtcactgcagtctgcgcacggtgcctgacatccccttc
tacttcttcttcaatgcgctcctgctgctgctcacccttatgaacctctactggttcctg
tacatcgtggcgtttgcagccaaggtgttgacaggccaggtgcacgagctgaaggacctg
cgggagtatgacacagccgaggcccagagcctgaagcccagcaaagccgagaagccactg
aggaacggcctggtgaaggacaagcgcttctga

DBGET integrated database retrieval system