KEGG   Homo sapiens (human): 1072Help
Entry
1072              CDS       T01001                                 

Gene name
CFL1, CFL, HEL-S-15, cofilin
Definition
(RefSeq) cofilin 1
  KO
K05765  cofilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05133  Pertussis
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
  Element
N00433  CXCR4-GNB/G-RAC signaling pathway
N00434  HIV gp120 to CXCR4-GNB/G-RAC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    1072 (CFL1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    1072 (CFL1)
  09158 Development and regeneration
   04360 Axon guidance
    1072 (CFL1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    1072 (CFL1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    1072 (CFL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1072 (CFL1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    1072 (CFL1)
   04147 Exosome [BR:hsa04147]
    1072 (CFL1)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Others
    1072 (CFL1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     1072 (CFL1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   1072 (CFL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cofilin_ADF
Motif
Other DBs
NCBI-GeneID: 1072
NCBI-ProteinID: NP_005498
OMIM: 601442
HGNC: 1874
Ensembl: ENSG00000172757
Vega: OTTHUMG00000166602
Pharos: P23528(Tbio)
UniProt: P23528 V9HWI5
Structure
PDB: 

Position
11q13.1
AA seq 166 aa AA seqDB search
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV
GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcctccggtgtggctgtctctgatggtgtcatcaaggtgttcaacgacatgaaggtg
cgtaagtcttcaacgccagaggaggtgaagaagcgcaagaaggcggtgctcttctgcctg
agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtgggcgatgtg
ggccagactgtcgacgacccctacgccacctttgtcaagatgctgccagataaggactgc
cgctatgccctctatgatgcaacctatgagaccaaggagagcaagaaggaggatctggtg
tttatcttctgggcccccgagtctgcgccccttaagagcaaaatgatttatgccagctcc
aaggacgccatcaagaagaagctgacagggatcaagcatgaattgcaagcaaactgctac
gaggaggtcaaggaccgctgcaccctggcagagaagctggggggcagtgccgtcatctcc
ctggagggcaagcctttgtga

DBGET integrated database retrieval system