KEGG   Homo sapiens (human): 10720Help
Entry
10720             CDS       T01001                                 

Gene name
UGT2B11
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member B11
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    10720 (UGT2B11)
   00053 Ascorbate and aldarate metabolism
    10720 (UGT2B11)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    10720 (UGT2B11)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    10720 (UGT2B11)
   00860 Porphyrin and chlorophyll metabolism
    10720 (UGT2B11)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    10720 (UGT2B11)
   00982 Drug metabolism - cytochrome P450
    10720 (UGT2B11)
   00983 Drug metabolism - other enzymes
    10720 (UGT2B11)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    10720 (UGT2B11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    10720 (UGT2B11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     10720 (UGT2B11)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   10720 (UGT2B11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 10720
NCBI-ProteinID: NP_001064
OMIM: 603064
HGNC: 12545
Ensembl: ENSG00000213759
Vega: OTTHUMG00000129395
Pharos: O75310(Tbio)
UniProt: O75310
Position
4q13.2
AA seq 529 aa AA seqDB search
MTLKWTSVLLLIHLSCYFSSGSCGKVLVWAAEYSHWMNMKTILKELVQRGHEVTVLASSA
SILFDPNDASTLKFEVYPTSLTKTEFENIIMQQVKRWSDIRKDSFWLYFSQEQEILWELY
DIFRNFCKDVVSNKKVMKKLQESRFDIVFADAVFPCGELLAALLNIRFVYSLRFTPGYTI
ERHSGGLIFPPSYIPIVMSKLSDQMTFMERVKNMIYVLYFDFWFQMSDMKKWDQFYSEVL
GRPTTLFETMGKADIWLMRNSWSFQFPHPFLPNVDFVGGFHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSVISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRLDFNTM
SSTDLLNALKTVINDPLYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMPHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLACVATVIFIITKFCLFCFWKFARKGKKGKRD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgactctgaaatggacttcagttcttctgctgatacatctcagttgttactttagctct
gggagttgtggaaaagtgctggtgtgggccgcagaatacagccattggatgaatatgaag
acaatcctgaaagagcttgttcagagaggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaatgatgcatccactcttaaatttgaagtttatcctacatct
ttaactaaaactgaatttgagaatatcatcatgcaacaggttaagagatggtcagacatt
cgaaaagatagcttttggttatatttttcacaagaacaagaaatcctgtgggaattatat
gacatatttagaaacttctgtaaagatgtagtttcaaataagaaagttatgaaaaaacta
caagagtcaagatttgacatcgtttttgcagatgctgtttttccctgtggtgagctgctg
gctgcgctacttaacatacggtttgtgtacagtctccgctttactcctggctacacaatt
gaaaggcacagtggaggactgattttccctccttcctacatacctattgttatgtcaaaa
ttaagtgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttatttt
gacttttggttccaaatgtctgatatgaagaagtgggatcagttttacagtgaagtttta
ggaagacccactaccttatttgagacaatgggaaaagctgacatatggcttatgcgaaac
tcctggagttttcaatttcctcatccattcttaccaaacgttgattttgttggaggattc
cactgcaaacctgccaaacccctacctaaggaaatggaggagtttgtacagagctctgga
gaaaatggtgttgtggtgttttctctggggtcagtgataagtaacatgacagcagaaagg
gccaatgtaattgcaacagcccttgccaagatcccacaaaaggttctgtggagatttgac
gggaataaaccagatgccttaggtctcaatactcggctgtacaagtggataccccagaat
gaccttctaggtcatccaaaaaccagagcttttataactcatggtggagccaatggcatc
tatgaggcaatctaccatgggatccctatggtgggcattccattgttttttgatcaacct
gataacattgctcacatgaaggccaagggagcagctgttagattggacttcaacacaatg
tcgagtacagacctgctgaatgcactgaagacagtaattaatgatcctttatataaagag
aatattatgaaattatcaagaattcaacatgatcaaccagtaaagcccctggatcgagca
gtcttctggattgaatttgtcatgccccacaaaggagccaaacaccttcgagttgcagcc
catgacctcacctggttccagtaccactctttggatgtgattgggtttctgctggcctgt
gtggcaactgtgatatttatcatcacaaagttttgtctgttttgtttctggaagtttgct
agaaaagggaagaagggaaaaagagattag

KEGG   Homo sapiens (human): 10941Help
Entry
10941             CDS       T01001                                 

Gene name
UGT2A1, UDPGT2A1
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member A1 complex locus
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    10941 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    10941 (UGT2A1)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    10941 (UGT2A1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    10941 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    10941 (UGT2A1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    10941 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    10941 (UGT2A1)
   00983 Drug metabolism - other enzymes
    10941 (UGT2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    10941 (UGT2A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    10941 (UGT2A1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     10941 (UGT2A1)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   10941 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 10941
NCBI-ProteinID: NP_001239204
OMIM: 604716
HGNC: 12542
Ensembl: ENSG00000173610
Vega: OTTHUMG00000184942
UniProt: Q9Y4X1
Position
4q13.3
AA seq 527 aa AA seqDB search
MLNNLLLFSLQISLIGTTLGGNVLIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALF
ITPTSNPSLTFEIYKVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHM
VSQEICDGVLKNQQLMAKLKKSKFEVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTVE
KHCGKVPYPPSYVPAVLSELTDQMSFTDRIRNFISYHLQDYMFETLWKSWDSYYSKALGG
LLLCCPGWSAVADLGSLQPLLPGFKRFSRLSLHCSWDYRLPAGRPTTLCETMGKAEIWLI
RTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKVLWRYKGKKPATLGNNTQLFDWIPQNDL
LGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNLNTMTS
VDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHD
LTWFQYHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacaaccttctgctgttctcccttcagataagtctcataggaaccactcttggt
gggaatgttttgatttggccaatggaaggtagtcattggctaaatgttaagataattata
gatgagctcattaaaaaggagcataatgtgactgtcctagttgcctctggtgcacttttc
atcacaccaacctctaacccatctctgacatttgaaatatataaggtgccctttggcaaa
gaaagaatagaaggagtaattaaggacttcgttttgacatggctggaaaatagaccatct
ccttcaaccatttggagattctatcaggagatggccaaagtaatcaaggacttccacatg
gtgtctcaggagatctgtgatggcgttcttaaaaaccaacagctgatggcaaagctaaag
aaaagcaagtttgaagtcctggtgtctgatccagtatttccttgtggcgatatagtagct
ttaaaacttggaattccatttatgtactccttgaggttttctccagcctcaacagtggaa
aagcactgtgggaaggtaccataccctccttcctatgttcctgctgttttatcagaactc
accgaccaaatgtctttcactgacagaataagaaatttcatctcctaccacctacaggac
tacatgtttgaaactctttggaaatcatgggattcatactatagtaaagctttaggtgga
ctcttactctgttgcccaggctggagtgcagtggcggatcttggctcactgcaacctctg
cttcccgggttcaagcgattctcccgcctcagcctccattgtagttgggattacaggctg
ccagcaggaagacccactacgttatgtgagactatggggaaagctgaaatttggttaatc
cgaacatattgggattttgaatttcctcgtccatacttacctaattttgagtttgttgga
ggattgcactgcaaacctgccaaacctttacctaaggttttatggagatacaaaggaaag
aaaccagccacattaggaaacaatactcagctctttgattggataccccagaatgatctt
cttggacatcccaaaaccaaagcttttatcactcatggtggaactaatgggatctacgaa
gctatttaccacggagtccctatggtgggagttcccatgtttgctgatcagcctgataac
attgctcacatgaaggccaaaggagcagctgtggaagtgaacctaaacacaatgacaagt
gtggatttgcttagcgctttgagaacagtcattaatgaaccttcttataaagagaatgct
atgaggttatcaagaattcaccatgatcaacctgtaaagcccctggatcgagcagtcttc
tggatcgagtttgtcatgcgccacaaaggagccaagcaccttcgggttgcagcccatgac
ctcacctggttccagtaccactctttggatgtaattgggttcttgctggtctgtgtgaca
acggctatatttttggtcatacaatgttgtttgttttcctgtcaaaaatttggtaagata
ggaaagaagaaaaaaagagaatag

KEGG   Homo sapiens (human): 54490Help
Entry
54490             CDS       T01001                                 

Gene name
UGT2B28
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member B28
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54490 (UGT2B28)
   00053 Ascorbate and aldarate metabolism
    54490 (UGT2B28)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    54490 (UGT2B28)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54490 (UGT2B28)
   00860 Porphyrin and chlorophyll metabolism
    54490 (UGT2B28)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54490 (UGT2B28)
   00982 Drug metabolism - cytochrome P450
    54490 (UGT2B28)
   00983 Drug metabolism - other enzymes
    54490 (UGT2B28)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    54490 (UGT2B28)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    54490 (UGT2B28)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54490 (UGT2B28)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54490 (UGT2B28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 54490
NCBI-ProteinID: NP_444267
OMIM: 606497
HGNC: 13479
Ensembl: ENSG00000135226
Vega: OTTHUMG00000129401
Pharos: Q9BY64(Tdark)
UniProt: Q9BY64
Position
4q13.2
AA seq 529 aa AA seqDB search
MALKWTSVLLLIHLGCYFSSGSCGKVLVWTGEYSHWMNMKTILKELVQRGHEVTVLASSA
SILFDPNDAFTLKLEVYPTSLTKTEFENIIMQQVKRWSDIQKDSFWLYFSQEQEILWEFH
DIFRNFCKDVVSNKKVMKKLQESRFDIIFADAFFPCGELLAALLNIPFVYSLCFTPGYTI
ERHSGGLIFPPSYIPVVMSKLSDQMTFMERVKNMIYVLYFDFWFQMCDMKKWDQFYSEVL
GRPTTLFETMGKADIWLMRNSWSFQFPHPFLPNIDFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSVISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQN
DLLGLPKTRAFITHGGANGIYEAIYHGIPMVGIPLFWDQPDNIAHMKAKGAAVRLDFHTM
SSTDLLNALKTVINDPSYKENVMKLSIIQHDQPVKPLHRAVFWIEFVMCHKGAKHLRVAA
RDLTWFQYHSLDVIGFLLACVATVIFVVTKFCLFCFWKFARKGKKGKRD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaagtggacttcagttcttctgctgatacatctcggttgttactttagctct
gggagttgtggaaaggtgctggtgtggaccggtgaatacagccattggatgaatatgaag
acaatcctgaaagagcttgttcagagaggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaatgacgcattcactcttaaactcgaagtttatcctacatct
ttaactaaaactgaatttgagaatatcatcatgcaacaggttaagagatggtcagacatt
caaaaagatagcttttggttatatttttcacaagaacaagaaatcctgtgggaatttcat
gacatatttagaaacttctgtaaagatgtagtttcaaataagaaagttatgaaaaaacta
caagagtcaagatttgacatcatttttgcagatgctttttttccttgtggtgagctgctg
gctgcgctacttaacataccgtttgtgtacagtctctgcttcactcctggctacacaatt
gaaaggcacagtggaggactgattttccctccttcctacatacctgttgttatgtcaaaa
ttaagtgatcaaatgactttcatggagagggtaaaaaacatgatctatgtgctttatttt
gacttttggttccaaatgtgtgatatgaagaagtgggatcagttttacagtgaagtttta
ggaagacccactaccttatttgagacaatggggaaagctgacatatggcttatgcgaaac
tcctggagttttcaatttcctcatccattcttaccaaacattgattttgttggaggactc
cactgcaaacctgccaaacccctacctaaggaaatggaggaatttgtacagagctctggt
gaaaatggtgttgtggtgttttctctggggtcagtgataagtaacatgacagcagaaagg
gccaacgtaattgcaacagcccttgccaagatcccacaaaaggttctgtggagatttgat
gggaataaaccagatgccttaggtctcaatactcggctgtataagtggataccccagaat
gaccttctaggtcttccaaaaaccagagcttttataactcatggtggagccaatggcatc
tatgaggcaatctaccatgggatccctatggtaggcattccattgttttgggatcaacct
gataacattgctcacatgaaggccaagggagcagctgttagactggacttccacacaatg
tcgagtacagacctgctgaatgcactgaagacagtaattaatgatccttcatataaagag
aatgttatgaaattatcaataattcaacatgatcaaccagtaaagcccctgcatcgagca
gtcttctggattgaatttgtgatgtgccacaaaggagccaaacaccttcgagttgcagcc
cgtgacctcacctggttccagtaccactctttggatgtgattgggtttctgctggcctgt
gtggcaactgtgatatttgtcgtcacaaagttttgtctgttttgtttctggaagtttgct
agaaaagggaagaagggaaaaagagattag

KEGG   Homo sapiens (human): 54575Help
Entry
54575             CDS       T01001                                 

Gene name
UGT1A10, GNT1, UDPGT, UGT-1A, UGT-1J, UGT1, UGT1-01, UGT1-10, UGT1.1, UGT1.10, UGT1A, UGT1A1, UGT1J, hUG-BR1
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A10
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54575 (UGT1A10)
   00053 Ascorbate and aldarate metabolism
    54575 (UGT1A10)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    54575 (UGT1A10)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54575 (UGT1A10)
   00860 Porphyrin and chlorophyll metabolism
    54575 (UGT1A10)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54575 (UGT1A10)
   00982 Drug metabolism - cytochrome P450
    54575 (UGT1A10)
   00983 Drug metabolism - other enzymes
    54575 (UGT1A10)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    54575 (UGT1A10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    54575 (UGT1A10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54575 (UGT1A10)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54575 (UGT1A10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 54575
NCBI-ProteinID: NP_061948
OMIM: 606435
HGNC: 12531
Ensembl: ENSG00000242515
Vega: OTTHUMG00000059121
Pharos: Q9HAW8(Tbio)
UniProt: Q9HAW8 Q5DT02
Position
2q37.1
AA seq 530 aa AA seqDB search
MARAGWTSPVPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP
EVSWQLERSLNCTVKTYSTSYTLEDQNREFMVFAHAQWKAQAQSIFSLLMSSSSGFLDLF
FSHCRSLFNDRKLVEYLKESSFDAVFLDPFDTCGLIVAKYFSLPSVVFTRGIFCHHLEEG
AQCPAPLSYVPNDLLGFSDAMTFKERVWNHIVHLEDHLFCQYLFRNALEIASEILQTPVT
AYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgcagggtggaccagccccgttcctttatgtgtgtgtctactgctgacctgt
ggctttgccgaggcagggaagctgctggtagtgcccatggatgggagtcactggttcacc
atgcagtcggtggtggagaaacttatcctcagggggcatgaggtggttgtagtcatgcca
gaggtgagttggcaactggaaagatcactgaattgcacagtgaagacttactcaacctcg
tacactctggaagatcagaaccgggaattcatggttttcgcccatgctcaatggaaagca
caggcacaaagtatattttctctattaatgagttcatccagtggttttcttgacttattt
ttttcgcattgcaggagtttgtttaatgaccgaaaattagtagaatacttaaaggagagt
tcttttgatgcagtgtttctggatccttttgatacctgtggcttaattgttgctaaatat
ttctccctcccctctgtggtcttcaccaggggaatattttgccaccatcttgaagaaggt
gcacagtgccctgctcctctttcctatgtccccaatgatctcttagggttctcagatgcc
atgactttcaaggagagagtatggaaccacatcgtgcacttggaggaccatttattttgc
cagtatctttttagaaatgccctagaaatagcctctgaaattctccaaacccctgtcacg
gcatatgatctctacagtcacacatcaatttggttgttgcgaacggactttgttttggac
tatcccaaacccgtgatgcccaacatgatcttcattggtggtatcaactgtcatcaggga
aagccattgcctatggaatttgaagcctacattaatgcttctggagaacatggaattgtg
gttttctctttgggatcaatggtctcagaaattccagagaagaaagctatggcaattgct
gatgctttgggcaaaatccctcagacagtcctgtggcggtacactggaacccgaccatcg
aatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgatctgcttggtcac
ccgatgacccgtgcctttatcacccatgctggttcccatggtgtttatgaaagcatatgc
aatggcgttcccatggtgatgatgcccttgtttggtgatcagatggacaatgcaaagcgc
atggagactaagggagctggagtgaccctgaatgttctggaaatgacttctgaagattta
gaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaacatcatgcgcctc
tccagccttcacaaggaccgcccggtggagccgctggacctggccgtgttctgggtggag
tttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccacgacctcacctgg
taccagtaccattccttggacgtgattggtttcctcttggccgtcgtgctgacagtggcc
ttcatcacctttaaatgttgtgcttatggctaccggaaatgcttggggaaaaaagggcga
gttaagaaagcccacaaatccaagacccattga

KEGG   Homo sapiens (human): 54576Help
Entry
54576             CDS       T01001                                 

Gene name
UGT1A8, GNT1, UDPGT, UDPGT_1-8, UGT-1A, UGT-1H, UGT1, UGT1-01, UGT1-08, UGT1.1, UGT1.8, UGT1A, UGT1A1, UGT1A8S, UGT1H, hUG-BR1
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A8
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54576 (UGT1A8)
   00053 Ascorbate and aldarate metabolism
    54576 (UGT1A8)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    54576 (UGT1A8)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54576 (UGT1A8)
   00860 Porphyrin and chlorophyll metabolism
    54576 (UGT1A8)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54576 (UGT1A8)
   00982 Drug metabolism - cytochrome P450
    54576 (UGT1A8)
   00983 Drug metabolism - other enzymes
    54576 (UGT1A8)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    54576 (UGT1A8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    54576 (UGT1A8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54576 (UGT1A8)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54576 (UGT1A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 54576
NCBI-ProteinID: NP_061949
OMIM: 606433
HGNC: 12540
Ensembl: ENSG00000242366
Vega: OTTHUMG00000059123
Pharos: Q9HAW9(Tbio)
UniProt: Q9HAW9 Q5DSZ6
Position
2q37.1
AA seq 530 aa AA seqDB search
MARTGWTSPIPLCVSLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP
EVSWQLGKSLNCTVKTYSTSYTLEDLDREFMDFADAQWKAQVRSLFSLFLSSSNGFFNLF
FSHCRSLFNDRKLVEYLKESSFDAVFLDPFDACGLIVAKYFSLPSVVFARGIACHYLEEG
AQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLFCQYFSKNALEIASEILQTPVT
AYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcacagggtggaccagccccattcccctatgtgtttctctgctgctgacctgt
ggctttgctgaggcagggaagctgctggtagtgcccatggatgggagtcactggttcacc
atgcagtcggtggtggagaaacttatcctcagggggcatgaggtggttgtagtcatgcca
gaggtgagttggcaactgggaaaatcactgaattgcacagtgaagacttactcaacctca
tacactctggaggatctggaccgggaattcatggatttcgccgatgctcaatggaaagca
caagtacgaagtttgttttctctatttctgagttcatccaatggtttttttaacttattt
ttttcgcattgcaggagtttgtttaatgaccgaaaattagtagaatacttaaaggagagt
tcttttgatgcggtgtttcttgatccttttgatgcctgtggcttaattgttgccaaatat
ttctccctcccctctgtggtcttcgccaggggaatagcttgccactatcttgaagaaggt
gcacagtgccctgctcctctttcctatgtccccagaattctcttagggttctcagatgcc
atgactttcaaggagagagtacggaaccacatcatgcacttggaggaacatttattttgc
cagtatttttccaaaaatgccctagaaatagcctctgaaattctccaaacacctgtcaca
gcatatgatctctacagccacacatcaatttggttgttgcgaacagactttgttttggac
tatcccaaacccgtgatgcccaatatgatcttcattggtggtatcaactgccatcaggga
aagccattgcctatggaatttgaagcctacattaatgcttctggagaacatggaattgtg
gttttctctttgggatcaatggtctcagaaattccagagaagaaagctatggcaattgct
gatgctttgggcaaaatccctcagacagtcctgtggcggtacactggaacccgaccatcg
aatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgatctgcttggtcac
ccgatgacccgtgcctttatcacccatgctggttcccatggtgtttatgaaagcatatgc
aatggcgttcccatggtgatgatgcccttgtttggtgatcagatggacaatgcaaagcgc
atggagactaagggagctggagtgaccctgaatgttctggaaatgacttctgaagattta
gaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaacatcatgcgcctc
tccagccttcacaaggaccgcccggtggagccgctggacctggccgtgttctgggtggag
tttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccacgacctcacctgg
taccagtaccattccttggacgtgattggtttcctcttggccgtcgtgctgacagtggcc
ttcatcacctttaaatgttgtgcttatggctaccggaaatgcttggggaaaaaagggcga
gttaagaaagcccacaaatccaagacccattga

KEGG   Homo sapiens (human): 54577Help
Entry
54577             CDS       T01001                                 

Gene name
UGT1A7, GNT1, UDPGT, UDPGT_1-7, UGT-1A, UGT-1G, UGT1, UGT1-01, UGT1-07, UGT1.1, UGT1.7, UGT1A, UGT1A1, UGT1G, hUG-BR1
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A7
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54577 (UGT1A7)
   00053 Ascorbate and aldarate metabolism
    54577 (UGT1A7)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    54577 (UGT1A7)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54577 (UGT1A7)
   00860 Porphyrin and chlorophyll metabolism
    54577 (UGT1A7)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54577 (UGT1A7)
   00982 Drug metabolism - cytochrome P450
    54577 (UGT1A7)
   00983 Drug metabolism - other enzymes
    54577 (UGT1A7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    54577 (UGT1A7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    54577 (UGT1A7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54577 (UGT1A7)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54577 (UGT1A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 54577
NCBI-ProteinID: NP_061950
OMIM: 606432
HGNC: 12539
Ensembl: ENSG00000244122
Vega: OTTHUMG00000059004
Pharos: Q9HAW7(Tbio)
UniProt: Q9HAW7 Q5DSZ7
Position
2q37.1
AA seq 530 aa AA seqDB search
MARAGWTGLLPLYVCLLLTCGFAKAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP
EVSWQLGRSLNCTVKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLF
FSNCRSLFNDRKLVEYLKESCFDAVFLDPFDACGLIVAKYFSLPSVVFARGIFCHYLEEG
AQCPAPLSYVPRLLLGFSDAMTFKERVWNHIMHLEEHLFCPYFFKNVLEIASEILQTPVT
AYDLYSHTSIWLLRTDFVLEYPKPVMPNMIFIGGINCHQGKPVPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgcagggtggactggcctccttcccctatatgtgtgtctactgctgacctgt
ggctttgccaaggcagggaagctgctggtagtgcccatggatgggagccactggttcacc
atgcagtcggtggtggagaaactcatcctcagggggcatgaggtggtcgtagtcatgcca
gaggtgagttggcaactgggaagatcactgaattgcacagtgaagacttactcaacctca
tacactctggaggatcaggaccgggagttcatggtttttgccgatgctcgctggacggca
ccattgcgaagtgcattttctctattaacaagttcatccaatggtatttttgacttattt
ttttcaaattgcaggagtttgtttaatgaccgaaaattagtagaatacttaaaggagagt
tgttttgatgcagtgtttctcgatccttttgatgcctgtggcttaattgttgccaaatat
ttctccctcccctctgtggtcttcgccaggggaatattttgccactatcttgaagaaggt
gcacagtgccctgctcctctttcctatgtccccagacttctcttagggttctcagacgcc
atgactttcaaggagagagtatggaaccacatcatgcacttggaggaacatttattttgc
ccctattttttcaaaaatgtcttagaaatagcctctgaaattctccaaacccctgtcacg
gcatatgatctctacagccacacatcaatttggttgttgcgaactgactttgttttggag
tatcccaaacccgtgatgcccaatatgatcttcattggtggtatcaactgtcatcaggga
aagccagtgcctatggaatttgaagcctacattaatgcttctggagaacatggaattgtg
gttttctctttgggatcaatggtctcagaaattccagagaagaaagctatggcaattgct
gatgctttgggcaaaatccctcagacagtcctgtggcggtacactggaacccgaccatcg
aatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgatctgcttggtcac
ccgatgacccgtgcctttatcacccatgctggttcccatggtgtttatgaaagcatatgc
aatggcgttcccatggtgatgatgcccttgtttggtgatcagatggacaatgcaaagcgc
atggagactaagggagctggagtgaccctgaatgttctggaaatgacttctgaagattta
gaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaacatcatgcgcctc
tccagccttcacaaggaccgcccggtggagccgctggacctggccgtgttctgggtggag
tttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccacgacctcacctgg
taccagtaccattccttggacgtgattggtttcctcttggccgtcgtgctgacagtggcc
ttcatcacctttaaatgttgtgcttatggctaccggaaatgcttggggaaaaaagggcga
gttaagaaagcccacaaatccaagacccattga

KEGG   Homo sapiens (human): 54578Help
Entry
54578             CDS       T01001                                 

Gene name
UGT1A6, GNT1, HLUGP, HLUGP1, UDPGT, UDPGT_1-6, UGT-1A, UGT-1C, UGT-1E, UGT1, UGT1-01, UGT1-03, UGT1-05, UGT1.1, UGT1.3, UGT1.5, UGT1A, UGT1A1, UGT1A3, UGT1A5, UGT1A6S, UGT1C, UGT1E, UGT1F, hUG-BR1
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A6
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54578 (UGT1A6)
   00053 Ascorbate and aldarate metabolism
    54578 (UGT1A6)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    54578 (UGT1A6)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54578 (UGT1A6)
   00860 Porphyrin and chlorophyll metabolism
    54578 (UGT1A6)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54578 (UGT1A6)
   00982 Drug metabolism - cytochrome P450
    54578 (UGT1A6)
   00983 Drug metabolism - other enzymes
    54578 (UGT1A6)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    54578 (UGT1A6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    54578 (UGT1A6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54578 (UGT1A6)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54578 (UGT1A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 54578
NCBI-ProteinID: NP_001063
OMIM: 606431
HGNC: 12538
Ensembl: ENSG00000167165
Vega: OTTHUMG00000059122
Pharos: P19224(Tbio)
UniProt: P19224 Q5DSZ8
Position
2q37.1
AA seq 532 aa AA seqDB search
MACLLRSFQRISAGVFFLALWGMVVGDKLLVVPQDGSHWLSMKDIVEVLSDRGHEIVVVV
PEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIG
LYFINCQSLLQDRDTLNFFKESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEH
TFSRSPDPVSYIPRCYTKFSDHMTFSQRVANFLVNLLEPYLFYCLFSKYEELASAVLKRD
VDIITLYQKVSVWLLRYDFVLEYPRPVMPNMVFIGGINCKKRKDLSQEFEAYINASGEHG
IVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLL
GHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSE
DLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDL
TWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcctccttcgctcatttcagagaatttctgcaggggttttcttcttagcactt
tggggcatggttgtaggtgacaagctgctggtggtccctcaggacggaagccactggctt
agtatgaaggatatagttgaggttctcagtgaccggggtcatgagattgtagtggtggtg
cctgaagttaatttgcttttgaaagaatccaaatactacacaagaaaaatctatccagtg
ccgtatgaccaagaagagctgaagaaccgttaccaatcatttggaaacaatcactttgct
gagcgatcattcctaactgctcctcagacagagtacaggaataacatgattgttattggc
ctgtacttcatcaactgccagagcctcctgcaggacagggacaccctgaacttctttaag
gagagcaagtttgatgctcttttcacagacccagccttaccctgtggggtgatcctggct
gagtatttgggcctaccatctgtgtacctcttcaggggttttccgtgttccctggagcat
acattcagcagaagcccagaccctgtgtcctacattcccaggtgctacacaaagttttca
gaccacatgactttttcccaacgagtggccaacttccttgttaatttgttggagccctat
ctattttattgtctgttttcaaagtatgaagaactcgcatcagctgtcctcaagagagat
gtggatataatcaccttatatcagaaggtctctgtttggctgttaagatatgactttgtg
cttgaatatcctaggccggtcatgcccaacatggtcttcattggaggtatcaactgtaag
aagaggaaagacttgtctcaggaatttgaagcctacattaatgcttctggagaacatgga
attgtggttttctctttgggatcaatggtctcagaaattccagagaagaaagctatggca
attgctgatgctttgggcaaaatccctcagacagtcctgtggcggtacactggaacccga
ccatcgaatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgatctgctt
ggtcacccgatgacccgtgcctttatcacccatgctggttcccatggtgtttatgaaagc
atatgcaatggcgttcccatggtgatgatgcccttgtttggtgatcagatggacaatgca
aagcgcatggagactaagggagctggagtgaccctgaatgttctggaaatgacttctgaa
gatttagaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaacatcatg
cgcctctccagccttcacaaggaccgcccggtggagccgctggacctggccgtgttctgg
gtggagtttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccacgacctc
acctggtaccagtaccattccttggacgtgattggtttcctcttggccgtcgtgctgaca
gtggccttcatcacctttaaatgttgtgcttatggctaccggaaatgcttggggaaaaaa
gggcgagttaagaaagcccacaaatccaagacccattga

KEGG   Homo sapiens (human): 54579Help
Entry
54579             CDS       T01001                                 

Gene name
UGT1A5, UDPGT, UDPGT_1-5, UGT1E
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A5
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54579 (UGT1A5)
   00053 Ascorbate and aldarate metabolism
    54579 (UGT1A5)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    54579 (UGT1A5)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54579 (UGT1A5)
   00860 Porphyrin and chlorophyll metabolism
    54579 (UGT1A5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54579 (UGT1A5)
   00982 Drug metabolism - cytochrome P450
    54579 (UGT1A5)
   00983 Drug metabolism - other enzymes
    54579 (UGT1A5)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    54579 (UGT1A5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    54579 (UGT1A5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54579 (UGT1A5)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54579 (UGT1A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 54579
NCBI-ProteinID: NP_061951
OMIM: 606430
HGNC: 12537
Ensembl: ENSG00000240224
Vega: OTTHUMG00000059120
Pharos: P35504(Tdark)
UniProt: P35504 Q5DSZ9
Position
2q37.1
AA seq 534 aa AA seqDB search
MATGLQVPLPQLATGLLLLLSVQPWAESGKVLVVPTDGSHWLSMREALRDLHARGHQVVV
LTLEVNMYIKEENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM
SLIIHRSCVELLHNEALIRHLHATSFDVVLTDPFHLCAAVLAKYLSIPAVFFLRNIPCDL
DFKGTQCPNPSSYIPRLLTTNSDHMTFLQRVKNMLYPLALSYLCHAVSAPYASLASELFQ
REVSVVDLVSHASVWLFRGDFVMDYPRPIMPNMVFIGGINCANGKPLSQEFEAYINASGE
HGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQND
LLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMT
SEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAH
DLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccacaggactccaggttcccctgccgcagctggccacaggactgctgcttctcctc
agtgtccagccctgggctgagagtgggaaggtgctggtggtgcccactgatggcagccac
tggctcagcatgcgggaggccttgcgggacctccatgcgagaggccaccaggtggtggtc
ctcaccctggaggtgaatatgtacatcaaagaagagaactttttcaccctgacaacgtat
gccatttcatggacccaggacgaatttgatcgccttttgctgggtcacactcaatcgttc
tttgaaacagaacatcttctgatgaaattttctagaagaatggcaattatgaacaatatg
tctttgatcatacataggtcttgtgtggagctactgcataatgaggccctgatcaggcac
ctgcatgctacttcctttgatgtggttctaacagacccctttcacctctgcgcggcggtg
ctggctaagtacctgtcgattcctgctgtgtttttcttgaggaacattccatgtgattta
gactttaagggcacacagtgtccaaacccttcctcctatattcctagattactaacgacc
aattcagaccacatgacattcctgcaaagggtcaagaacatgctctaccctctggccctg
tcctacctttgccatgctgtttctgctccttatgcaagccttgcctctgagctttttcag
agagaggtgtcagtggtggatcttgtcagccatgcatctgtgtggctgttccgaggggac
tttgtgatggattaccccaggccgatcatgcccaacatggtcttcattgggggcatcaac
tgtgccaacgggaagccactatctcaggaatttgaagcctacattaatgcttctggagaa
catggaattgtggttttctctttgggatcaatggtctcagaaattccagagaagaaagct
atggcaattgctgatgctttgggcaaaatccctcagacagtcctgtggcggtacactgga
acccgaccatcgaatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgat
ctgcttggtcacccgatgacccgtgcctttatcacccatgctggttcccatggtgtttat
gaaagcatatgcaatggcgttcccatggtgatgatgcccttgtttggtgatcagatggac
aatgcaaagcgcatggagactaagggagctggagtgaccctgaatgttctggaaatgact
tctgaagatttagaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaac
atcatgcgcctctccagccttcacaaggaccgcccggtggagccgctggacctggccgtg
ttctgggtggagtttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccac
gacctcacctggtaccagtaccattccttggacgtgattggtttcctcttggccgtcgtg
ctgacagtggccttcatcacctttaaatgttgtgcttatggctaccggaaatgcttgggg
aaaaaagggcgagttaagaaagcccacaaatccaagacccattga

KEGG   Homo sapiens (human): 54600Help
Entry
54600             CDS       T01001                                 

Gene name
UGT1A9, HLUGP4, LUGP4, UDPGT, UDPGT_1-9, UGT-1I, UGT1-09, UGT1-9, UGT1.9, UGT1A9S, UGT1AI, UGT1I
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A9
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54600 (UGT1A9)
   00053 Ascorbate and aldarate metabolism
    54600 (UGT1A9)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    54600 (UGT1A9)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54600 (UGT1A9)
   00860 Porphyrin and chlorophyll metabolism
    54600 (UGT1A9)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54600 (UGT1A9)
   00982 Drug metabolism - cytochrome P450
    54600 (UGT1A9)
   00983 Drug metabolism - other enzymes
    54600 (UGT1A9)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    54600 (UGT1A9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    54600 (UGT1A9)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54600 (UGT1A9)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54600 (UGT1A9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 54600
NCBI-ProteinID: NP_066307
OMIM: 606434
HGNC: 12541
Ensembl: ENSG00000241119
Vega: OTTHUMG00000059124
Pharos: O60656(Tbio)
UniProt: O60656 Q5DSZ5
Position
2q37.1
AA seq 530 aa AA seqDB search
MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMP
EVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLF
FSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIVAKYFSLPSVVFARGILCHYLEEG
AQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLLCHRFFKNALEIASEILQTPVT
EYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcacagggtggaccagcccccttcctctatgtgtgtgtctgctgctgacctgt
ggctttgccgaggcagggaagctactggtagtgcccatggatgggagccactggttcacc
atgaggtcggtggtggagaaactcattctcagggggcatgaggtggttgtagtcatgcca
gaggtgagttggcaactgggaagatcactgaattgcacagtgaagacttattcaacttca
tataccctggaggatctggaccgggagttcaaggcttttgcccatgctcaatggaaagca
caagtacgaagtatatattctctattaatgggttcatacaatgacatttttgacttattt
ttttcaaattgcaggagtttgtttaaagacaaaaaattagtagaatacttaaaggagagt
tcttttgatgcagtgtttctcgatccttttgataactgtggcttaattgttgccaaatat
ttctccctcccctccgtggtcttcgccaggggaatactttgccactatcttgaagaaggt
gcacagtgccctgctcctctttcctatgtccccagaattctcttagggttctcagatgcc
atgactttcaaggagagagtacggaaccacatcatgcacttggaggaacatttattatgc
caccgttttttcaaaaatgccctagaaatagcctctgaaattctccaaacacctgttacg
gagtatgatctctacagccacacatcaatttggttgttgcgaacggactttgttttggac
tatcccaaacccgtgatgcccaacatgatcttcattggtggtatcaactgccatcaggga
aagccgttgcctatggaatttgaagcctacattaatgcttctggagaacatggaattgtg
gttttctctttgggatcaatggtctcagaaattccagagaagaaagctatggcaattgct
gatgctttgggcaaaatccctcagacagtcctgtggcggtacactggaacccgaccatcg
aatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgatctgcttggtcac
ccgatgacccgtgcctttatcacccatgctggttcccatggtgtttatgaaagcatatgc
aatggcgttcccatggtgatgatgcccttgtttggtgatcagatggacaatgcaaagcgc
atggagactaagggagctggagtgaccctgaatgttctggaaatgacttctgaagattta
gaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaacatcatgcgcctc
tccagccttcacaaggaccgcccggtggagccgctggacctggccgtgttctgggtggag
tttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccacgacctcacctgg
taccagtaccattccttggacgtgattggtttcctcttggccgtcgtgctgacagtggcc
ttcatcacctttaaatgttgtgcttatggctaccggaaatgcttggggaaaaaagggcga
gttaagaaagcccacaaatccaagacccattga

KEGG   Homo sapiens (human): 54657Help
Entry
54657             CDS       T01001                                 

Gene name
UGT1A4, GNT1, HUG-BR2, UDPGT, UDPGT_1-4, UGT-1A, UGT-1D, UGT1, UGT1-01, UGT1-04, UGT1.1, UGT1.4, UGT1A, UGT1A1, UGT1A4S, UGT1D, hUG-BR1
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A4
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54657 (UGT1A4)
   00053 Ascorbate and aldarate metabolism
    54657 (UGT1A4)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    54657 (UGT1A4)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54657 (UGT1A4)
   00860 Porphyrin and chlorophyll metabolism
    54657 (UGT1A4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54657 (UGT1A4)
   00982 Drug metabolism - cytochrome P450
    54657 (UGT1A4)
   00983 Drug metabolism - other enzymes
    54657 (UGT1A4)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    54657 (UGT1A4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    54657 (UGT1A4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54657 (UGT1A4)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54657 (UGT1A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 54657
NCBI-ProteinID: NP_009051
OMIM: 606429
HGNC: 12536
Ensembl: ENSG00000244474
Vega: OTTHUMG00000059119
Pharos: P22310(Tbio)
UniProt: P22310
Position
2q37.1
AA seq 534 aa AA seqDB search
MARGLQVPLPRLATGLLLLLSVQPWAESGKVLVVPTDGSPWLSMREALRELHARGHQAVV
LTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLKRYSRSMAIMNNV
SLALHRCCVELLHNEALIRHLNATSFDVVLTDPVNLCGAVLAKYLSIPAVFFWRYIPCDL
DFKGTQCPNPSSYIPKLLTTNSDHMTFLQRVKNMLYPLALSYICHTFSAPYASLASELFQ
REVSVVDLVSYASVWLFRGDFVMDYPRPIMPNMVFIGGINCANGKPLSQEFEAYINASGE
HGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQND
LLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMT
SEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAH
DLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccagaggactccaggttcccctgccgcggctggccacaggactgctgctcctcctc
agtgtccagccctgggctgagagtggaaaggtgttggtggtgcccactgatggcagcccc
tggctcagcatgcgggaggccttgcgggagctccatgccagaggccaccaggcggtggtc
ctcaccccagaggtgaatatgcacatcaaagaagagaaatttttcaccctgacagcctat
gctgttccatggacccagaaggaatttgatcgcgttacgctgggctacactcaagggttc
tttgaaacagaacatcttctgaagagatattctagaagtatggcaattatgaacaatgta
tctttggcccttcataggtgttgtgtggagctactgcataatgaggccctgatcaggcac
ctgaatgctacttcctttgatgtggttttaacagaccccgttaacctctgtggggcggtg
ctggctaagtacctgtcgattcctgctgtgtttttttggaggtacattccatgtgactta
gactttaagggcacacagtgtccaaatccttcctcctatattcctaagttactaacgacc
aattcagaccacatgacattcctgcaaagggtcaagaacatgctctaccctctggccctg
tcctacatttgccatactttttctgccccttatgcaagtcttgcctctgagctttttcag
agagaggtgtcagtggtggatcttgtcagctatgcatccgtgtggctgttccgaggggac
tttgtgatggactaccccaggccgatcatgcccaacatggtcttcattgggggcatcaac
tgtgccaacgggaagccactatctcaggaatttgaagcctacattaatgcttctggagaa
catggaattgtggttttctctttgggatcaatggtctcagaaattccagagaagaaagct
atggcaattgctgatgctttgggcaaaatccctcagacagtcctgtggcggtacactgga
acccgaccatcgaatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgat
ctgcttggtcacccgatgacccgtgcctttatcacccatgctggttcccatggtgtttat
gaaagcatatgcaatggcgttcccatggtgatgatgcccttgtttggtgatcagatggac
aatgcaaagcgcatggagactaagggagctggagtgaccctgaatgttctggaaatgact
tctgaagatttagaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaac
atcatgcgcctctccagccttcacaaggaccgcccggtggagccgctggacctggccgtg
ttctgggtggagtttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccac
gacctcacctggtaccagtaccattccttggacgtgattggtttcctcttggccgtcgtg
ctgacagtggccttcatcacctttaaatgttgtgcttatggctaccggaaatgcttgggg
aaaaaagggcgagttaagaaagcccacaaatccaagacccattga

KEGG   Homo sapiens (human): 54658Help
Entry
54658             CDS       T01001                                 

Gene name
UGT1A1, BILIQTL1, GNT1, HUG-BR1, UDPGT, UDPGT_1-1, UGT1, UGT1A
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Disease
H00208  Hyperbilirubinemia
H02054  Crigler-Najjar syndrome
H02055  Gilbert syndrome
H02152  Transient familial neonatal hyperbilirubinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54658 (UGT1A1)
   00053 Ascorbate and aldarate metabolism
    54658 (UGT1A1)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    54658 (UGT1A1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54658 (UGT1A1)
   00860 Porphyrin and chlorophyll metabolism
    54658 (UGT1A1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54658 (UGT1A1)
   00982 Drug metabolism - cytochrome P450
    54658 (UGT1A1)
   00983 Drug metabolism - other enzymes
    54658 (UGT1A1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    54658 (UGT1A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    54658 (UGT1A1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54658 (UGT1A1)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54658 (UGT1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 54658
NCBI-ProteinID: NP_000454
OMIM: 191740
HGNC: 12530
Ensembl: ENSG00000241635
Vega: OTTHUMG00000059117
Pharos: P22309(Tbio)
UniProt: P22309 Q5DT03
Position
2q37.1
AA seq 533 aa AA seqDB search
MAVESQGGRPLVLGLLLCVLGPVVSHAGKILLIPVDGSHWLSMLGAIQQLQQRGHEIVVL
APDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDS
AMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLE
FEATQCPNPFSYVPRPLSSHSDHMTFLQRVKNMLIAFSQNFLCDVVYSPYATLASEFLQR
EVTVQDLLSSASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH
GIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDL
LGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTS
EDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHD
LTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggagtcccagggcggacgcccacttgtcctgggcctgctgctgtgtgtgctg
ggcccagtggtgtcccatgctgggaagatactgttgatcccagtggatggcagccactgg
ctgagcatgcttggggccatccagcagctgcagcagaggggacatgaaatagttgtccta
gcacctgacgcctcgttgtacatcagagacggagcattttacaccttgaagacgtaccct
gtgccattccaaagggaggatgtgaaagagtcttttgttagtctcgggcataatgttttt
gagaatgattctttcctgcagcgtgtgatcaaaacatacaagaaaataaaaaaggactct
gctatgcttttgtctggctgttcccacttactgcacaacaaggagctcatggcctccctg
gcagaaagcagctttgatgtcatgctgacggaccctttccttccttgcagccccatcgtg
gcccagtacctgtctctgcccactgtattcttcttgcatgcactgccatgcagcctggaa
tttgaggctacccagtgccccaacccattctcctacgtgcccaggcctctctcctctcat
tcagatcacatgaccttcctgcagcgggtgaagaacatgctcattgccttttcacagaac
tttctgtgcgacgtggtttattccccgtatgcaacccttgcctcagaattccttcagaga
gaggtgactgtccaggacctattgagctctgcatctgtctggctgtttagaagtgacttt
gtgaaggattaccctaggcccatcatgcccaatatggtttttgttggtggaatcaactgc
cttcaccaaaatccactatcccaggaatttgaagcctacattaatgcttctggagaacat
ggaattgtggttttctctttgggatcaatggtctcagaaattccagagaagaaagctatg
gcaattgctgatgctttgggcaaaatccctcagacagtcctgtggcggtacactggaacc
cgaccatcgaatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgatctg
cttggtcacccgatgacccgtgcctttatcacccatgctggttcccatggtgtttatgaa
agcatatgcaatggcgttcccatggtgatgatgcccttgtttggtgatcagatggacaat
gcaaagcgcatggagactaagggagctggagtgaccctgaatgttctggaaatgacttct
gaagatttagaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaacatc
atgcgcctctccagccttcacaaggaccgcccggtggagccgctggacctggccgtgttc
tgggtggagtttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccacgac
ctcacctggtaccagtaccattccttggacgtgattggtttcctcttggccgtcgtgctg
acagtggccttcatcacctttaaatgttgtgcttatggctaccggaaatgcttggggaaa
aaagggcgagttaagaaagcccacaaatccaagacccattga

KEGG   Homo sapiens (human): 54659Help
Entry
54659             CDS       T01001                                 

Gene name
UGT1A3, UDPGT, UDPGT_1-3, UGT-1C, UGT1-03, UGT1.3, UGT1A3S, UGT1C
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A3
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54659 (UGT1A3)
   00053 Ascorbate and aldarate metabolism
    54659 (UGT1A3)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    54659 (UGT1A3)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54659 (UGT1A3)
   00860 Porphyrin and chlorophyll metabolism
    54659 (UGT1A3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54659 (UGT1A3)
   00982 Drug metabolism - cytochrome P450
    54659 (UGT1A3)
   00983 Drug metabolism - other enzymes
    54659 (UGT1A3)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    54659 (UGT1A3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    54659 (UGT1A3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54659 (UGT1A3)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54659 (UGT1A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 54659
NCBI-ProteinID: NP_061966
OMIM: 606428
HGNC: 12535
Ensembl: ENSG00000243135
Vega: OTTHUMG00000059118
Pharos: P35503(Tbio)
UniProt: P35503 Q5DT01
Position
2q37.1
AA seq 534 aa AA seqDB search
MATGLQVPLPWLATGLLLLLSVQPWAESGKVLVVPIDGSHWLSMREVLRELHARGHQAVV
LTPEVNMHIKEENFFTLTTYAISWTQDEFDRHVLGHTQLYFETEHFLKKFFRSMAMLNNM
SLVYHRSCVELLHNEALIRHLNATSFDVVLTDPVNLCAAVLAKYLSIPTVFFLRNIPCDL
DFKGTQCPNPSSYIPRLLTTNSDHMTFMQRVKNMLYPLALSYICHAFSAPYASLASELFQ
REVSVVDILSHASVWLFRGDFVMDYPRPIMPNMVFIGGINCANRKPLSQEFEAYINASGE
HGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQND
LLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMT
SEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAH
DLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggccacaggactccaggttcccctgccgtggctggccacaggactgctgcttctcctc
agtgtccagccctgggctgagagtggaaaggtgttggtggtgcccattgatggcagccac
tggctcagcatgcgggaggtcttgcgggagctccatgccagaggccaccaggcagtggtc
ctcaccccagaggtgaatatgcacatcaaagaagagaactttttcaccctgacaacctat
gccatttcgtggacccaggatgaatttgatcgccatgtgctgggccacactcaactgtac
tttgaaacagaacattttctgaagaaatttttcagaagtatggcaatgttgaacaatatg
tctttggtctatcataggtcttgtgtggagctactacataatgaggccctgatcaggcac
ctgaatgctacttcctttgatgtggttttaacagaccccgttaacctctgcgcggcagtg
ctggctaagtacctgtcgattcctactgtgttttttttgaggaacattccatgtgattta
gactttaagggcacacagtgtccaaacccttcctcctatattcctagattactaacaacc
aattcagaccacatgacattcatgcaaagggtcaagaacatgctctaccctctggccctg
tcctacatttgccatgctttttctgctccttatgcaagccttgcctctgagctttttcag
agagaggtgtcagtggtggatattctcagtcatgcatctgtgtggctgttccgaggggac
tttgtgatggactaccccaggccaatcatgcccaacatggtcttcattgggggcatcaac
tgtgccaacaggaagccactatctcaggaatttgaagcctacattaatgcttctggagaa
catggaattgtggttttctctttgggatcaatggtctcagaaattccagagaagaaagct
atggcaattgctgatgctttgggcaaaatccctcagacagtcctgtggcggtacactgga
acccgaccatcgaatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgat
ctgcttggtcacccgatgacccgtgcctttatcacccatgctggttcccatggtgtttat
gaaagcatatgcaatggcgttcccatggtgatgatgcccttgtttggtgatcagatggac
aatgcaaagcgcatggagactaagggagctggagtgaccctgaatgttctggaaatgact
tctgaagatttagaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaac
atcatgcgcctctccagccttcacaaggaccgcccggtggagccgctggacctggccgtg
ttctgggtggagtttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccac
gacctcacctggtaccagtaccattccttggacgtgattggtttcctcttggccgtcgtg
ctgacagtggccttcatcacctttaaatgttgtgcttatggctaccggaaatgcttgggg
aaaaaagggcgagttaagaaagcccacaaatccaagacccattga

KEGG   Homo sapiens (human): 574537Help
Entry
574537            CDS       T01001                                 

Gene name
UGT2A2
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member A2
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    574537 (UGT2A2)
   00053 Ascorbate and aldarate metabolism
    574537 (UGT2A2)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    574537 (UGT2A2)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    574537 (UGT2A2)
   00860 Porphyrin and chlorophyll metabolism
    574537 (UGT2A2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    574537 (UGT2A2)
   00982 Drug metabolism - cytochrome P450
    574537 (UGT2A2)
   00983 Drug metabolism - other enzymes
    574537 (UGT2A2)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    574537 (UGT2A2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    574537 (UGT2A2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     574537 (UGT2A2)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   574537 (UGT2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 574537
NCBI-ProteinID: NP_001099147
HGNC: 28183
Ensembl: ENSG00000271271
Vega: OTTHUMG00000129398
Pharos: Q9Y4X1(Tdark)
UniProt: Q9Y4X1
Position
4q13.3
AA seq 536 aa AA seqDB search
MVSIRDFTMPKKFVQMLVFNLTLTEVVLSGNVLIWPTDGSHWLNIKIILEELIQRNHNVT
VLASSATLFINSNPDSPVNFEVIPVSYKKSNIDSLIEHMIMLWIDHRPTPLTIWAFYKEL
GKLLDTFFQINIQLCDGVLKNPKLMARLQKGGFDVLVADPVTICGDLVALKLGIPFMYTL
RFSPASTVERHCGKIPAPVSYVPAALSELTDQMTFGERIKNTISYSLQDYIFQSYWGEWN
SYYSKILGRPTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEME
EFIQSSGKNGVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKKPATLGNNTQL
FDWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAV
EVNLNTMTSVDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGA
KHLRVAAHDLTWFQYHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggtttccataagggattttaccatgcctaagaagtttgtccagatgctggtttttaat
ttgactctgactgaagttgttctaagtgggaatgtgttaatttggcctacagatggtagc
cattggttaaatattaagattattctagaagagttgattcaaagaaatcacaatgtgact
gtactggcttcatcagcaactctattcatcaactccaatcccgattctcctgtgaatttt
gaagtgatacctgtttcctacaagaagagcaatatagattccttaattgagcatatgata
atgctgtggattgaccatagaccaactcctctcacaatatgggctttctacaaagaacta
ggaaaacttctagacactttctttcaaattaacatacaactctgtgatggtgtactaaag
aacccaaagttgatggcaagacttcagaaaggtggttttgatgtgttggtagcagaccca
gtaacaatctgtggtgatcttgttgctctgaaattaggaattccatttatgtacacattg
aggttctctccagcatcaacagtggagagacactgtgggaaaatcccagcaccagtctcc
tatgtaccggcagccttatcagagctcactgaccagatgacctttggtgaaaggattaaa
aataccatatcttattctctgcaagactatatatttcagtcctactggggagaatggaat
tcatactatagcaaaattttaggaagacccactacgttatgtgagactatggggaaagct
gaaatttggttaatccgaacatattgggattttgaatttcctcgtccatacttacctaat
tttgagtttgttggaggattgcactgcaaacctgccaaacctttacctaaggaaatggaa
gaatttatccagagctcaggtaaaaatggtgttgtggtgttttctctgggatcaatggtc
aaaaaccttacagaagaaaaggccaatcttattgcctcagcccttgcccagattccacag
aaggttttatggagatacaaaggaaagaaaccagccacattaggaaacaatactcagctc
tttgattggataccccagaatgatcttcttggacatcccaaaaccaaagcttttatcact
catggtggaactaatgggatctacgaagctatttaccacggagtccctatggtgggagtt
cccatgtttgctgatcagcctgataacattgctcacatgaaggccaaaggagcagctgtg
gaagtgaacctaaacacaatgacaagtgtggatttgcttagcgctttgagaacagtcatt
aatgaaccttcttataaagagaatgctatgaggttatcaagaattcaccatgatcaacct
gtaaagcccctggatcgagcagtcttctggatcgagtttgtcatgcgccacaaaggagcc
aagcaccttcgggttgcagcccatgacctcacctggttccagtaccactctttggatgta
attgggttcttgctggtctgtgtgacaacggctatatttttggtcatacaatgttgtttg
ttttcctgtcaaaaatttggtaagataggaaagaagaaaaaaagagaatag

KEGG   Homo sapiens (human): 7363Help
Entry
7363              CDS       T01001                                 

Gene name
UGT2B4, HLUG25, UDPGT2B4, UDPGTH1, UDPGTh-1, UGT2B11
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member B4
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa04976  Bile secretion
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    7363 (UGT2B4)
   00053 Ascorbate and aldarate metabolism
    7363 (UGT2B4)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    7363 (UGT2B4)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    7363 (UGT2B4)
   00860 Porphyrin and chlorophyll metabolism
    7363 (UGT2B4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    7363 (UGT2B4)
   00982 Drug metabolism - cytochrome P450
    7363 (UGT2B4)
   00983 Drug metabolism - other enzymes
    7363 (UGT2B4)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    7363 (UGT2B4)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    7363 (UGT2B4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    7363 (UGT2B4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     7363 (UGT2B4)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   7363 (UGT2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4 Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 7363
NCBI-ProteinID: NP_066962
OMIM: 600067
HGNC: 12553
Ensembl: ENSG00000156096
Vega: OTTHUMG00000058891
Pharos: P06133(Tbio)
UniProt: P06133
Position
4q13.3
AA seq 528 aa AA seqDB search
MSMKWTSALLLIQLSCYFSSGSCGKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSA
SISFDPNSPSTLKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFN
DILRKFCKDIVSNKKLMKKLQESRFDVVLADAVFPFGELLAELLKIPFVYSLRFSPGYAI
EKHSGGLLFPPSYVPVVMSELSDQMTFIERVKNMIYVLYFEFWFQIFDMKKWDQFYSEVL
GRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTM
SSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVTGFLLACVATVIFIITKCLFCVWKFVRTGKKGKRD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaaatggacttcagctcttctgctgatacagctgagctgttactttagctct
gggagttgtggaaaggtgctggtgtggcccacagaattcagccactggatgaatataaag
acaatcctggatgaacttgtccagagaggtcatgaggtgactgtattggcatcttcagct
tccatttctttcgatcccaacagcccatctactcttaaatttgaagtttatcctgtatct
ttaactaaaactgagtttgaggatattatcaagcagctggttaagagatgggcagaactt
ccaaaagacacattttggtcatatttttcacaagtacaagaaatcatgtggacatttaat
gacatacttagaaagttctgtaaggatatagtttcaaataagaaacttatgaagaaacta
caggagtcaagatttgatgttgttcttgcagatgctgttttcccctttggtgagctgctg
gccgagttacttaaaataccctttgtctacagcctccgcttctctcctggctacgcaatt
gaaaagcatagtggaggacttctgttccctccttcctatgtgcctgttgttatgtcagaa
ctaagtgaccaaatgactttcatagagagggtaaaaaatatgatctatgtgctttatttt
gaattttggttccaaatatttgacatgaagaagtgggatcagttctacagtgaagttcta
ggaagacccactacgttatctgagacaatggcaaaagctgacatatggcttattcgaaac
tactgggattttcaatttcctcacccactcttaccaaatgttgagttcgttggaggactc
cactgcaaacctgccaaacccctaccgaaggaaatggaagagtttgtccagagctctgga
gaaaatggtgttgtggtgttttctctggggtcgatggtcagtaacacgtcagaagaaagg
gccaatgtaattgcatcagcccttgccaagatcccacaaaaggttctgtggagatttgat
gggaataaaccagatactttaggactcaatactcggctgtacaagtggataccccagaat
gatcttcttggtcacccaaaaaccagagcttttataactcatggtggagccaatggcatc
tatgaggcaatctaccatggaatccctatggtgggcgttccattgtttgcagatcaacct
gataacattgcacacatgaaggccaagggagcagctgttagtttggacttccacacaatg
tcgagtacagacttactcaatgcactgaagacagtaattaatgatcctttatataaagag
aatgctatgaaattatcaagaattcatcatgatcaaccagtgaagccccttgatcgagca
gtcttctggattgaatttgtcatgcgccataaaggagccaagcaccttcgggttgcagcc
cacgacctcacctggttccagtaccactctttggatgtgactgggttcctgctggcctgt
gtggcaactgtgatattcatcatcacaaaatgtctgttttgtgtctggaagtttgttaga
acaggaaagaaggggaaaagagattaa

KEGG   Homo sapiens (human): 7364Help
Entry
7364              CDS       T01001                                 

Gene name
UGT2B7, UDPGT_2B7, UDPGT_2B9, UDPGT2B7, UDPGTH2, UDPGTh-2, UGT2B9
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member B7
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    7364 (UGT2B7)
   00053 Ascorbate and aldarate metabolism
    7364 (UGT2B7)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    7364 (UGT2B7)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    7364 (UGT2B7)
   00860 Porphyrin and chlorophyll metabolism
    7364 (UGT2B7)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    7364 (UGT2B7)
   00982 Drug metabolism - cytochrome P450
    7364 (UGT2B7)
   00983 Drug metabolism - other enzymes
    7364 (UGT2B7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    7364 (UGT2B7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    7364 (UGT2B7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     7364 (UGT2B7)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   7364 (UGT2B7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 7364
NCBI-ProteinID: NP_001065
OMIM: 600068
HGNC: 12554
Ensembl: ENSG00000171234
Vega: OTTHUMG00000129404
Pharos: P16662(Tchem)
UniProt: P16662
Structure
PDB: 

Position
4q13.2
AA seq 529 aa AA seqDB search
MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSA
SILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFG
DITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTF
EKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVL
GRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSG
ENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTM
SSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKKGKND
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaatggacttcagtaattttgctaatacaactgagcttttgctttagctct
gggaattgtggaaaggtgctggtgtgggcagcagaatacagccattggatgaatataaag
acaatcctggatgagcttattcagagaggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaacaactcatccgctcttaaaattgaaatttatcccacatct
ttaactaaaactgagttggagaatttcatcatgcaacagattaagagatggtcagacctt
ccaaaagatacattttggttatatttttcacaagtacaggaaatcatgtcaatatttggt
gacataactagaaagttctgtaaagatgtagtttcaaataagaaatttatgaaaaaagta
caagagtcaagatttgacgtcatttttgcagatgctatttttccctgtagtgagctgctg
gctgagctatttaacataccctttgtgtacagtctcagcttctctcctggctacactttt
gaaaagcatagtggaggatttattttccctccttcctacgtacctgttgttatgtcagaa
ttaactgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttacttt
gacttttggttcgaaatatttgacatgaagaagtgggatcagttttatagtgaagttcta
ggaagacccactacattatctgagacaatggggaaagctgacgtatggcttattcgaaac
tcctggaattttcagtttccatatccactcttaccaaatgttgattttgttggaggactc
cactgcaaacctgccaaacccctgcctaaggaaatggaagactttgtacagagctctgga
gaaaatggtgttgtggtgttttctctggggtcaatggtcagtaacatgacagaagaaagg
gccaacgtaattgcatcagccctggcccagatcccacaaaaggttctgtggagatttgat
gggaataaaccagataccttaggtctcaatactcggctctacaagtggataccccagaat
gaccttctaggtcatccaaagaccagagcttttataactcatggtggagccaatggcatc
tacgaggcaatctaccatgggatccctatggtggggattccattgtttgccgatcaacct
gataacattgctcacatgaaggccaggggagcagctgttagagtggacttcaacacaatg
tcgagtacagacttgctgaatgcattgaagagagtaattaatgatccttcatataaagag
aatgttatgaaattatcaagaattcaacatgatcaaccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccacaaaggagctaaacaccttcgggttgcagcc
cacgacctcacctggttccagtaccactctttggatgtgattgggttcctgctggtctgt
gtggcaactgtgatatttatcgtcacaaaatgttgtctgttttgtttctggaagtttgct
agaaaagcaaagaagggaaaaaatgattag

KEGG   Homo sapiens (human): 7365Help
Entry
7365              CDS       T01001                                 

Gene name
UGT2B10, UDPGT2B10
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member B10
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    7365 (UGT2B10)
   00053 Ascorbate and aldarate metabolism
    7365 (UGT2B10)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    7365 (UGT2B10)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    7365 (UGT2B10)
   00860 Porphyrin and chlorophyll metabolism
    7365 (UGT2B10)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    7365 (UGT2B10)
   00982 Drug metabolism - cytochrome P450
    7365 (UGT2B10)
   00983 Drug metabolism - other enzymes
    7365 (UGT2B10)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    7365 (UGT2B10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    7365 (UGT2B10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     7365 (UGT2B10)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   7365 (UGT2B10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 SKA2 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 7365
NCBI-ProteinID: NP_001066
OMIM: 600070
HGNC: 12544
Ensembl: ENSG00000109181
Vega: OTTHUMG00000161505
Pharos: P36537(Tbio)
UniProt: P36537
Position
4q13.2
AA seq 528 aa AA seqDB search
MALKWTTVLLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSAS
ILFDPNDSSTLKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAIND
IIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGELLAELFNIPFVYSHSFSPGYSFE
RHSGGFIFPPSYVPVVMSKLSDQMTFMERVKNMLYVLYFDFWFQIFNMKKWDQFYSEVLG
RPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGE
NGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQND
LLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMS
STDLLNALKTVINDPSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAH
NLTWFQYHSLDVIGFLLACVATVLFIITKCCLFCFWKFARKGKKGKRD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaaatggactacagttctgctgatacaactcagtttttactttagctctggg
agttgtggaaaggtgctggtatgggccgcagaatacagcctttggatgaatatgaagaca
atcctgaaagaacttgttcagagaggtcatgaggtgactgtactggcatcttcagcttcc
attctttttgatcccaacgactcatccactcttaaacttgaagtttatcctacatcttta
actaaaactgaatttgagaatatcatcatgcaattggttaagagattgtcagaaattcaa
aaagatacattttggttacctttttcacaagaacaagaaatcctgtgggcaattaatgac
ataattagaaacttctgtaaagatgtagtttcaaataagaaacttatgaaaaaactacaa
gagtcaagatttgacatcgtttttgcagatgcttatttaccctgtggtgagctgctggct
gagctatttaacataccctttgtgtacagtcacagcttcagtcctggctactcatttgaa
aggcacagtggaggatttattttccctccttcctacgtacctgttgttatgtcaaaatta
agtgatcaaatgactttcatggagagggtaaaaaatatgctctatgtgctttattttgac
ttttggttccaaatatttaatatgaagaagtgggatcagttttacagtgaagttttagga
agacccactacattatctgagacaatgaggaaagctgacatatggcttatgcgaaactcc
tggaattttaaatttcctcatccattcttaccaaatgttgattttgttggaggactccac
tgcaaacctgccaaacccctacctaaggaaatggaggagtttgtacagagctctggagaa
aatggtgttgtggtgttttctctggggtcaatggtcagtaacatgacagaagaaagggcc
aacgtaattgcaacagcccttgccaagatcccacaaaaggttctttggagatttgatggg
aataaaccagatgccttaggtctcaatactcgactgtacaagtggataccccagaatgac
cttctaggtcatccaaaaaccagagcttttataactcatggtggagccaatggcatctat
gaggcaatctaccatgggatccctatggtgggcattccattgttttttgatcaacctgat
aatattgctcacatgaaggccaagggagcagctgttagagtggacttcaacacaatgtcg
agtacagacctgctgaatgcactgaagacagtaattaatgatccttcatataaagagaat
attatgaaattatcaagaattcaacatgatcaaccagtgaagcccctggatcgagcagtc
ttctggattgaatttgtcatgcgccacaaaggagccaaacatcttcgagttgcagcccac
aacctcacctggttccagtaccactctttggatgtgattgggttcctgctggcttgtgtg
gcaaccgtgctatttatcatcacaaagtgttgtctgttttgtttctggaagtttgctaga
aaaggaaagaagggaaaaagggattag

KEGG   Homo sapiens (human): 7366Help
Entry
7366              CDS       T01001                                 

Gene name
UGT2B15, HLUG4, UDPGT_2B8, UDPGT2B15, UDPGTH3, UGT2B8
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member B15
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    7366 (UGT2B15)
   00053 Ascorbate and aldarate metabolism
    7366 (UGT2B15)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    7366 (UGT2B15)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    7366 (UGT2B15)
   00860 Porphyrin and chlorophyll metabolism
    7366 (UGT2B15)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    7366 (UGT2B15)
   00982 Drug metabolism - cytochrome P450
    7366 (UGT2B15)
   00983 Drug metabolism - other enzymes
    7366 (UGT2B15)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    7366 (UGT2B15)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    7366 (UGT2B15)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     7366 (UGT2B15)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   7366 (UGT2B15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 7366
NCBI-ProteinID: NP_001067
OMIM: 600069
HGNC: 12546
Ensembl: ENSG00000196620
Vega: OTTHUMG00000161507
Pharos: P54855(Tbio)
UniProt: P54855
Position
4q13.2
AA seq 530 aa AA seqDB search
MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSA
STLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEY
YDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYT
FEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEV
LGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSS
GENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQ
NDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRT
MSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVA
AHNLTWIQYHSLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRD
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgaaatggacgtcagtctttctgctgatacagctcagttgttactttagctct
ggaagctgtggaaaggtgctagtgtggcccacagaatacagccattggataaatatgaag
acaatcctggaagagcttgttcagaggggtcatgaggtgactgtgttgacatcttcggct
tctactcttgtcaatgccagtaaatcatctgctattaaattagaagtttatcctacatct
ttaactaaaaattatttggaagattctcttctgaaaattctcgatagatggatatatggt
gtttcaaaaaatacattttggtcatatttttcacaattacaagaattgtgttgggaatat
tatgactacagtaacaagctctgtaaagatgcagttttgaataagaaacttatgatgaaa
ctacaagagtcaaagtttgatgtcattctggcagatgcccttaatccctgtggtgagcta
ctggctgaactatttaacataccctttctgtacagtcttcgattctctgttggctacaca
tttgagaagaatggtggaggatttctgttccctccttcctatgtacctgttgttatgtca
gaattaagtgatcaaatgattttcatggagaggataaaaaatatgatacatatgctttat
tttgacttttggtttcaaatttatgatctgaagaagtgggaccagttttatagtgaagtt
ctaggaagacccactacattatttgagacaatggggaaagctgaaatgtggctcattcga
acctattgggattttgaatttcctcgcccattcttaccaaatgttgattttgttggagga
cttcactgtaaaccagccaaacccctgcctaaggaaatggaagagtttgtgcagagctct
ggagaaaatggtattgtggtgttttctctggggtcgatgatcagtaacatgtcagaagaa
agtgccaacatgattgcatcagcccttgcccagatcccacaaaaggttctatggagattt
gatggcaagaagccaaatactttaggttccaatactcgactgtacaagtggttaccccag
aatgaccttcttggtcatcccaaaaccaaagcttttataactcatggtggaaccaatggc
atctatgaggcgatctaccatgggatccctatggtgggcattcccttgtttgcggatcaa
catgataacattgctcacatgaaagccaagggagcagccctcagtgtggacatcaggacc
atgtcaagtagagatttgctcaatgcattgaagtcagtcattaatgaccctgtctataaa
gagaatgtcatgaaattatcaagaattcatcatgaccaaccaatgaagcccctggatcga
gcagtcttctggattgagtttgtcatgcgccacaaaggagccaagcaccttcgagtcgca
gctcacaacctcacctggatccagtaccactctttggatgtgatagcattcctgctggcc
tgcgtggcaactgtgatatttatcatcacaaaattttgcctgttttgtttccgaaagctt
gccaaaaaaggaaagaagaagaaaagagattag

KEGG   Homo sapiens (human): 7367Help
Entry
7367              CDS       T01001                                 

Gene name
UGT2B17, BMND12, UDPGT2B17
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member B17
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Disease
H01593  Osteoporosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    7367 (UGT2B17)
   00053 Ascorbate and aldarate metabolism
    7367 (UGT2B17)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    7367 (UGT2B17)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    7367 (UGT2B17)
   00860 Porphyrin and chlorophyll metabolism
    7367 (UGT2B17)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    7367 (UGT2B17)
   00982 Drug metabolism - cytochrome P450
    7367 (UGT2B17)
   00983 Drug metabolism - other enzymes
    7367 (UGT2B17)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    7367 (UGT2B17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    7367 (UGT2B17)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     7367 (UGT2B17)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   7367 (UGT2B17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 HCMV_UL139
Motif
Other DBs
NCBI-GeneID: 7367
NCBI-ProteinID: NP_001068
OMIM: 601903
HGNC: 12547
Ensembl: ENSG00000197888
Vega: OTTHUMG00000129305
Pharos: O75795(Tbio)
UniProt: O75795
Position
4q13.2
AA seq 530 aa AA seqDB search
MSLKWMSVFLLMQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSA
SILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEY
SDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYT
VEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEV
LGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSS
GENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQ
NDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRT
MSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVA
AHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgaaatggatgtcagtctttctgctgatgcagctcagttgttactttagctct
gggagttgtggaaaggtgctggtgtggcccacagaatacagccattggataaatatgaag
acaatcctggaagagcttgttcagaggggtcatgaggtgattgtgttgacatcttcggct
tctattcttgtcaatgccagtaaatcatctgctattaaattagaagtttatcctacatct
ttaactaaaaatgatttggaagatttttttatgaaaatgttcgatagatggacatatagt
atttcaaaaaatacattttggtcatatttttcacaactacaagaattgtgttgggaatat
tctgactataatataaagctctgtgaagatgcagttttgaacaagaaacttatgagaaaa
ctacaagagtcaaaatttgatgtccttctggcagatgccgttaatccctgtggtgagctg
ctggctgagctacttaacataccctttctgtacagtctccgcttctctgttggctacaca
gttgagaagaatggtggaggatttctgttccctccttcctatgtacctgttgttatgtca
gaattaagtgatcaaatgattttcatggagaggataaaaaatatgatatatatgctttat
tttgacttttggtttcaagcatatgatctgaagaagtgggaccagttttatagtgaagtt
ctaggaagacccactacattatttgagacaatggggaaagctgaaatgtggctcattcga
acctattgggattttgaatttcctcgcccattcttaccaaatgttgattttgttggagga
cttcactgtaaaccagccaaacccttgcctaaggaaatggaagagtttgtgcagagctct
ggagaaaatggtattgtggtgttttctctggggtcgatgatcagtaacatgtcagaagaa
agtgccaacatgattgcatcagcccttgcccagatcccacaaaaggttctatggagattt
gatggcaagaagccaaatactttaggttccaatactcgactgtataagtggttaccccag
aatgaccttcttggtcatcccaaaaccaaagcttttataactcatggtggaaccaatggc
atctatgaggcaatctaccatgggatccctatggtgggcattcccttgtttgcggatcaa
catgataacattgctcacatgaaagccaagggagcagccctcagtgtggacatcaggacc
atgtcaagtagagatttgctcaatgcattgaagtcagtcattaatgaccctatctataaa
gagaatatcatgaaattatcaagaattcatcatgatcaaccggtgaagcccctggatcga
gcagtcttctggattgagtttgtcatgcgccataaaggagccaagcaccttcgggtcgca
gcccacaacctcacctggatccagtaccactctttggatgtgatagcattcctgctggcc
tgcgtggcaactatgatatttatgatcacaaaatgttgcctgttttgtttccgaaagctt
gccaaaacaggaaagaagaagaaaagggattag

KEGG   Homo sapiens (human): 79799Help
Entry
79799             CDS       T01001                                 

Gene name
UGT2A3
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member A3
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    79799 (UGT2A3)
   00053 Ascorbate and aldarate metabolism
    79799 (UGT2A3)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    79799 (UGT2A3)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    79799 (UGT2A3)
   00860 Porphyrin and chlorophyll metabolism
    79799 (UGT2A3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    79799 (UGT2A3)
   00982 Drug metabolism - cytochrome P450
    79799 (UGT2A3)
   00983 Drug metabolism - other enzymes
    79799 (UGT2A3)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    79799 (UGT2A3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    79799 (UGT2A3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     79799 (UGT2A3)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   79799 (UGT2A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 79799
NCBI-ProteinID: NP_079019
OMIM: 616382
HGNC: 28528
Ensembl: ENSG00000135220
Vega: OTTHUMG00000129408
Pharos: Q6UWM9(Tbio)
UniProt: Q6UWM9
Position
4q13.2
AA seq 527 aa AA seqDB search
MRSDKSALVFLLLQLFCVGCGFCGKVLVWPCDMSHWLNVKVILEELIVRGHEVTVLTHSK
PSLIDYRKPSALKFEVVHMPQDRTEENEIFVDLALNVLPGLSTWQSVIKLNDFFVEIRGT
LKMMCESFIYNQTLMKKLQETNYDVMLIDPVIPCGDLMAELLAVPFVLTLRISVGGNMER
SCGKLPAPLSYVPVPMTGLTDRMTFLERVKNSMLSVLFHFWIQDYDYHFWEEFYSKALGR
PTTLCETVGKAEIWLIRTYWDFEFPQPYQPNFEFVGGLHCKPAKALPKEMENFVQSSGED
GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTRLYDWIPQNDL
LGHPKTKAFITHGGMNGIYEAIYHGVPMVGVPIFGDQLDNIAHMKAKGAAVEINFKTMTS
EDLLRALRTVITDSSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRSAAHD
LTWFQHYSIDVIGFLLACVATAIFLFTKCFLFSCQKFNKTRKIEKRE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctgacaagtcagctttggtatttctgctcctgcagctcttctgtgttggctgt
ggattctgtgggaaagtcctggtgtggccctgtgacatgagccattggcttaatgtcaag
gtcattctagaagagctcatagtgagaggccatgaggtaacagtattgactcactcaaag
ccttcgttaattgactacaggaagccttctgcattgaaatttgaggtggtccatatgcca
caggacagaacagaagaaaatgaaatatttgttgacctagctctgaatgtcttgccaggc
ttatcaacctggcaatcagttataaaattaaatgatttttttgttgaaataagaggaact
ttaaaaatgatgtgtgagagctttatctacaatcagacgcttatgaagaagctacaggaa
accaactacgatgtaatgcttatagaccctgtgattccctgtggagacctgatggctgag
ttgcttgcagtcccttttgtgctcacacttagaatttctgtaggaggcaatatggagcga
agctgtgggaaacttccagctccactttcctatgtacctgtgcctatgacaggactaaca
gacagaatgacctttctggaaagagtaaaaaattcaatgctttcagttttgttccacttc
tggattcaggattacgactatcatttttgggaagagttttatagtaaggcattaggaagg
cccactacattatgtgagactgtgggaaaagctgagatatggctaatacgaacatattgg
gattttgaatttcctcaaccataccaacctaactttgagtttgttggaggattgcactgt
aaacctgccaaagctttgcctaaggaaatggaaaattttgtccagagttcaggggaagat
ggtattgtggtgttttctctggggtcactgtttcaaaatgttacagaagaaaaggctaat
atcattgcttcagcccttgcccagatcccacagaaggtgttatggaggtacaaaggaaaa
aaaccatccacattaggagccaatactcggctgtatgattggataccccagaatgatctt
cttggtcatcccaaaaccaaagcttttatcactcatggtggaatgaatgggatctatgaa
gctatttaccatggggtccctatggtgggagttcccatatttggtgatcagcttgataac
atagctcacatgaaggccaaaggagcagctgtagaaataaacttcaaaactatgacaagc
gaagatttactgagggctttgagaacagtcattaccgattcctcttataaagagaatgct
atgagattatcaagaattcaccatgatcaacctgtaaagcccctagatcgagcagtcttc
tggatcgagtttgtcatgcgccacaaaggagccaagcacctgcgatcagctgcccatgac
ctcacctggttccagcactactctatagatgtgattgggttcctgctggcctgtgtggca
actgctatattcttgttcacaaaatgttttttattttcctgtcaaaaatttaataaaact
agaaagatagaaaagagggaatag

DBGET integrated database retrieval system