KEGG   Homo sapiens (human): 10723Help
Entry
10723             CDS       T01001                                 

Gene name
SLC12A7, KCC4
Definition
(RefSeq) solute carrier family 12 member 7
  KO
K13627  solute carrier family 12 (potassium/chloride transporter), member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04966  Collecting duct acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    10723 (SLC12A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10723 (SLC12A7)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   10723 (SLC12A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease SLC12
Motif
Other DBs
NCBI-GeneID: 10723
NCBI-ProteinID: NP_006589
OMIM: 604879
HGNC: 10915
Ensembl: ENSG00000113504
Vega: OTTHUMG00000161931
Pharos: Q9Y666(Tbio)
UniProt: Q9Y666
Position
5p15.33
AA seq 1083 aa AA seqDB search
MPTNFTVVPVEAHADGGGDETAERTEAPGTPEGPEPERPSPGDGNPRENSPFLNNVEVEQ
ESFFEGKNMALFEEEMDSNPMVSSLLNKLANYTNLSQGVVEHEEDEESRRREAKAPRMGT
FIGVYLPCLQNILGVILFLRLTWIVGVAGVLESFLIVAMCCTCTMLTAISMSAIATNGVV
PAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEIFLTYISPGAAIFQAEAA
GGEAAAMLHNMRVYGTCTLVLMALVVFVGVKYVNKLALVFLACVVLSILAIYAGVIKSAF
DPPDIPVCLLGNRTLSRRSFDACVKAYGIHNNSATSALWGLFCNGSQPSAACDEYFIQNN
VTEIQGIPGAASGVFLENLWSTYAHAGAFVEKKGVPSVPVAEESRASALPYVLTDIAASF
TLLVGIYFPSVTGIMAGSNRSGDLKDAQKSIPTGTILAIVTTSFIYLSCIVLFGACIEGV
VLRDKFGEALQGNLVIGMLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIARDGIVP
FLQVFGHGKANGEPTWALLLTVLICETGILIASLDSVAPILSMFFLMCYLFVNLACAVQT
LLRTPNWRPRFKFYHWTLSFLGMSLCLALMFICSWYYALSAMLIAGCIYKYIEYRGAEKE
WGDGIRGLSLNAARYALLRVEHGPPHTKNWRPQVLVMLNLDAEQAVKHPRLLSFTSQLKA
GKGLTIVGSVLEGTYLDKHMEAQRAEENIRSLMSTEKTKGFCQLVVSSSLRDGMSHLIQS
AGLGGLKHNTVLMAWPASWKQEDNPFSWKNFVDTVRDTTAAHQALLVAKNVDSFPQNQER
FGGGHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCRMRIFTVAQVDDNSIQMKKDLQMFLY
HLRISAEVEVVEMVENDISAFTYERTLMMEQRSQMLKQMQLSKNEQEREAQLIHDRNTAS
HTAAAARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNVRRMHTA
VKLNGVVLNKSQDAQLVLLNMPGPPKNRQGDENYMEFLEVLTEGLNRVLLVRGGGREVIT
IYS
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccaacttcaccgtggtgcccgtggaggctcacgccgacggcggcggggacgag
actgccgagcggacggaggctccgggcacccccgagggccccgagcccgagcgccccagc
ccgggagatggaaatccaagagaaaacagcccattcctcaacaatgtcgaggtggaacaa
gagagcttctttgaagggaagaacatggcacttttcgaggaggagatggacagtaacccc
atggtgtcctcgctgctcaacaagctggccaactacaccaacctgagccagggcgtggtg
gagcacgaggaggacgaggagagccggcggcgggaggccaaggctccgcgcatgggcacc
ttcatcggcgtctacctgccgtgcctgcagaacatcctgggcgtcatcctcttcctgcgc
ctgacgtggatcgtgggggtggctggtgtcctggagtccttcctcatcgtggccatgtgc
tgcacatgtacaatgctgaccgccatttccatgagtgcgatcgctaccaacggtgtggtc
ccagctggcgggtcctactacatgatatcgcgctcgctgggacccgagtttggaggcgct
gtcggcctctgcttctacctgggcacgacgtttgcaggggccatgtatattttggggacc
atcgagatttttctgacgtacatctccccgggtgcggccatcttccaggcggaggctgca
ggtggcgaggcggccgccatgctgcacaacatgcgtgtgtacggcacgtgcacgctcgtg
ctcatggccctggtggtcttcgtgggcgtcaagtatgtcaacaagctggcgctggtcttc
ctggcctgcgtcgtgctgtccatcctggccatctatgccggcgtcatcaagtctgccttc
gaccccccggacatcccggtctgcctcctggggaaccgcacgctgtcacggcgcagcttc
gatgcctgcgtcaaggcctacggcatccacaacaactcagccacctccgcgctctggggc
ctcttctgcaacggctcccagcccagcgccgcctgtgacgagtacttcatccagaacaac
gtcaccgaaatccagggcatcccgggcgcggccagtggtgtcttcctggagaacctgtgg
agtacgtacgcgcacgcgggggcgtttgtggagaagaaaggtgtgccctcggtgcccgtg
gcagaggagagccgtgccagcgcactgccctacgtgctcaccgacatcgcggcctccttc
accctgctggttggcatctacttcccttccgtgaccggtatcatggcgggttcaaaccgg
tccggggacctcaaggatgcacagaagtccatccccacggggaccatcctggccatagtg
acgacgtctttcatctatctctcctgcattgtgctgtttggggcctgcattgaaggcgtg
gtcttacgagataagttcggggaggccctgcaggggaacctggtcatcggcatgctggcc
tggccctccccctgggtcatcgtcatcggctccttcttctccacctgcggtgccggcctg
cagagcctcacgggggcaccgcgcctactgcaggccattgcccgtgacggcatcgtcccc
ttcctgcaggtgtttggccacgggaaggccaacggggagcccacgtgggcgctgctgctg
acagtcctcatctgcgagactggcatcctcatcgcctctctggacagcgtggccccgatc
ctctccatgttcttcctcatgtgctacctgttcgtgaacctggcctgcgccgtgcagacc
ctgctacgtacccccaactggcgtccacgcttcaagttctaccactggaccctgtccttt
ctgggtatgagcctgtgcctggcgctgatgttcatctgctcctggtactacgcgctgtcc
gccatgctcatcgctggctgcatctacaagtacatcgagtaccgcggggccgagaaggag
tggggcgatggcatccgtggcctatccctgaacgccgcccgctacgccctgctgcgcgtg
gagcacggtcccccccacaccaagaactggaggccccaggtgctggtgatgctgaacctg
gacgcggagcaggccgtgaagcacccccgcctgctgtccttcacgtcgcagctgaaggcc
ggcaagggcctgaccatcgtgggctcggtgctggaggggacgtacctggacaagcacatg
gaggctcagcgggccgaggagaacatacggtccctaatgagcacagagaagaccaagggc
ttctgccagctggtggtctcgtccagcctgcgggatggcatgtcccacctgatccagtcg
gccggcctgggcggcctgaagcacaacacggtgctcatggcctggcccgcatcctggaag
caggaggacaaccccttctcctggaagaactttgtggacaccgtccgcgacaccaccgcc
gcgcaccaggctctgctggtggccaagaacgtcgactcgtttccgcaaaaccaggagcgc
ttcggcgggggccacatcgacgtgtggtggatcgtgcacgacggcggcatgctcatgctg
ctgcccttcctgctgcgccagcacaaggtgtggaggaagtgccggatgcgtatcttcacc
gtggcccaggtggacgacaacagcatccagatgaagaaggacctgcagatgttcttgtac
cacttgcgcatcagcgccgaggtggaggtggtggagatggttgaaaacgacatatctgct
ttcacctacgagaggacactaatgatggagcagaggtcgcagatgctgaagcagatgcag
ctgtccaagaacgagcaggagcgagaggcccagctgatccacgacaggaacaccgcgtcc
cacaccgcggcggcagccaggacccaagcgccgcctacgccagacaaggtgcagatgacc
tggaccagggagaagctgatcgctgagaagtacaggagcagagacaccagcctatctggt
ttcaaagacctcttcagcatgaagccggaccagtccaacgtcaggcggatgcacacggct
gtgaagctcaatggcgtcgtcctcaacaagtcccaggatgcgcagctggtcctgctcaac
atgccaggtcctcccaaaaaccggcagggagacgagaactacatggagtttcttgaagtc
ctgaccgaggggctgaacagagtcctcctggtcaggggtggcggccgggaggtgatcacc
atctactcctaa

DBGET integrated database retrieval system