KEGG   Homo sapiens (human): 10726
Entry
10726             CDS       T01001                                 
Symbol
NUDC, HNUDC, MNUDC, NPD011
Name
(RefSeq) nuclear distribution C, dynein complex regulator
  KO
K25866  nuclear migration protein NudC
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10726 (NUDC)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Others
     10726 (NUDC)
SSDB
Motif
Pfam: CS NuDC Nudc_N
Other DBs
NCBI-GeneID: 10726
NCBI-ProteinID: NP_006591
OMIM: 610325
HGNC: 8045
Ensembl: ENSG00000090273
UniProt: Q9Y266
Structure
Position
1:26900161..26946871
AA seq 331 aa
MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFS
HHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEID
QKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSE
LDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKV
VTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMG
LPTSDEQKKQEILKKFMDQHPEMDFSKAKFN
NT seq 996 nt   +upstreamnt  +downstreamnt
atgggcggagagcaggaggaggagcggttcgacggcatgttgctggccatggctcagcag
cacgagggcggcgtgcaggagcttgtgaacaccttcttcagcttccttcgacgcaaaaca
gactttttcattggaggagaagaagggatggcagagaagcttatcacacagactttcagc
caccacaatcagctggcacagaagacccggcgggagaagagagcccggcaggaggccgag
cggcgggagaaggcggagcgggcggccagactggccaaggaagccaagtcagagacctca
gggccccagatcaaggagctaactgatgaagaggcagagaggctgcagctagagattgac
cagaaaaaggatgcagagaatcatgaggcccagctcaagaacggcagccttgactcccca
gggaagcaggatactgaggaagatgaggaggaagatgagaaggacaaaggaaaactgaag
cccaacctaggcaacggggcagacctgcccaattaccgctggacccagaccctgtcggag
ctggacctggcggtccctttctgtgtgaacttccggctgaaagggaaggacatggtggtg
gacatccagcggcggcacctccgggtggggctcaaggggcagccagcgatcattgatggg
gagctctacaatgaagtgaaggtggaggagagctcgtggctcattgaggacggcaaggtg
gtgactgtgcatctggagaagatcaataagatggagtggtggagccgcttggtgtccagt
gaccctgagatcaacaccaagaagattaaccctgagaattccaagctgtcagacctggac
agtgagactcgcagcatggtggaaaagatgatgtatgaccagcgacagaagtccatgggg
ctgccaacttcagacgaacagaagaaacaggagattctgaagaagttcatggatcaacat
ccggagatggatttttccaaggctaaattcaactag

DBGET integrated database retrieval system