KEGG   Homo sapiens (human): 10728Help
Entry
10728             CDS       T01001                                 

Gene name
PTGES3, P23, TEBP, cPGES
Definition
(RefSeq) prostaglandin E synthase 3
  KO
K15730  cytosolic prostaglandin-E synthase [EC:5.3.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    10728 (PTGES3)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.3  prostaglandin-E synthase
     10728 (PTGES3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CS
Motif
Other DBs
NCBI-GeneID: 10728
NCBI-ProteinID: NP_006592
OMIM: 607061
HGNC: 16049
Ensembl: ENSG00000110958
Vega: OTTHUMG00000170217
Pharos: Q15185(Tbio)
UniProt: Q15185 A0A024RB32
Structure
PDB: 

Position
12q13.3; 12
AA seq 160 aa AA seqDB search
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID
PNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNF
DRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctgcttctgcaaagtggtacgatcgaagggactatgtcttcattgaattttgt
gttgaagacagtaaggatgttaatgtaaattttgaaaaatccaaacttacattcagttgt
ctcggaggaagtgataattttaagcatttaaatgaaattgatctttttcactgtattgat
ccaaatgattccaagcataaaagaacggacagatcaattttatgttgtttacgaaaagga
gaatctggccagtcatggccaaggttaacaaaagaaagggcaaagcttaattggcttagt
gtcgacttcaataattggaaagactgggaagatgattcagatgaagacatgtctaatttt
gatcgtttctctgagatgatgaacaacatgggtggtgatgaggatgtagatttaccagaa
gtagatggagcagatgatgattcacaagacagtgatgatgaaaaaatgccagatctggag
taa

DBGET integrated database retrieval system