KEGG   Homo sapiens (human): 10728
Entry
10728             CDS       T01001                                 

Symbol
PTGES3, P23, TEBP, cPGES
Name
(RefSeq) prostaglandin E synthase 3
  KO
K15730  cytosolic prostaglandin-E synthase [EC:5.3.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    10728 (PTGES3)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    10728 (PTGES3)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.3  prostaglandin-E synthase
     10728 (PTGES3)
SSDB
Motif
Pfam: CS
Other DBs
NCBI-GeneID: 10728
NCBI-ProteinID: NP_006592
OMIM: 607061
HGNC: 16049
Ensembl: ENSG00000110958
Vega: OTTHUMG00000170217
Pharos: Q15185(Tbio)
UniProt: Q15185 A0A024RB32
Structure
PDB: 
1EJF

Position
12q13.3; 12
AA seq 160 aa
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID
PNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNF
DRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
NT seq 483 nt   +upstreamnt  +downstreamnt
atgcagcctgcttctgcaaagtggtacgatcgaagggactatgtcttcattgaattttgt
gttgaagacagtaaggatgttaatgtaaattttgaaaaatccaaacttacattcagttgt
ctcggaggaagtgataattttaagcatttaaatgaaattgatctttttcactgtattgat
ccaaatgattccaagcataaaagaacggacagatcaattttatgttgtttacgaaaagga
gaatctggccagtcatggccaaggttaacaaaagaaagggcaaagcttaattggcttagt
gtcgacttcaataattggaaagactgggaagatgattcagatgaagacatgtctaatttt
gatcgtttctctgagatgatgaacaacatgggtggtgatgaggatgtagatttaccagaa
gtagatggagcagatgatgattcacaagacagtgatgatgaaaaaatgccagatctggag
taa

KEGG   Homo sapiens (human): 80142
Entry
80142             CDS       T01001                                 

Symbol
PTGES2, C9orf15, GBF-1, GBF1, PGES2, mPGES-2
Name
(RefSeq) prostaglandin E synthase 2
  KO
K05309  microsomal prostaglandin-E synthase 2 [EC:5.3.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Disease
H00025  Penile cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    80142 (PTGES2)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.3  prostaglandin-E synthase
     80142 (PTGES2)
SSDB
Motif
Pfam: GST_N_3 Glutaredoxin GST_N_2 GST_N_4 GST_C_2 GST_C GST_N GST_C_3
Other DBs
NCBI-GeneID: 80142
NCBI-ProteinID: NP_079348
OMIM: 608152
HGNC: 17822
Ensembl: ENSG00000148334
Vega: OTTHUMG00000020730
Pharos: Q9H7Z7(Tchem)
UniProt: Q9H7Z7 B3KPZ2
Position
9q34.11
AA seq 377 aa
MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLG
AAALALGGALGLYHTARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFL
DFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQEGESSQQLNDSSVIISALKTYLVSGQ
PLEEIITYYPAMKAVNEQGKEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADD
WLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQ
DNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQ
PWYLRVERAITEASPAH
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggacccggctgcgcgggtggtgcgggcgctgtggcctggtgggtgcgccttggcctgg
aggctgggaggccgcccccagccgctgctacccacgcagagccgggctggcttcgcgggg
gcggcgggcggcccgagccccgtggctgcagctcgtaaggggagcccgcggctgctggga
gctgcggcgctggccctggggggagccctggggctgtaccacacggcgcggtggcacctg
cgcgcccaggacctccacgcagagcgctcagccgcgcagctctccctgtccagccgcctg
cagctgaccctgtaccagtacaagacgtgtcccttctgcagcaaggtccgagccttcctc
gacttccatgccctgccctaccaggtggtggaggtgaaccctgtgcgcagggctgagatc
aagttctcctcctacagaaaggtgcccatcctggtggcccaggaaggagaaagctcgcaa
caactaaatgactcctctgtcatcatcagcgccctcaagacctacctggtgtcggggcag
cccctggaagagatcatcacctactacccagccatgaaggctgtgaacgagcagggcaag
gaggtgaccgagttcggcaataagtactggctcatgctcaacgagaaggaggcccagcaa
gtgtatggtgggaaggaggccaggacggaggagatgaagtggcggcagtgggcggacgac
tggctggtgcacctgatctcccccaatgtgtaccgcacgcccaccgaggctctggcgtcc
tttgactacattgtccgcgagggcaagttcggagccgtggagggtgccgtggccaagtac
atgggtgcagcggccatgtacctcatcagcaagcgactcaagagcaggcaccgcctccag
gacaacgtgcgcgaggacctctatgaggctgctgacaagtgggtggctgctgtgggcaag
gaccggcccttcatggggggccagaagccgaatctcgctgatttggcggtgtatggcgtg
ctgcgtgtgatggaggggctggatgcgttcgatgacctgatgcagcacacgcacatccag
ccctggtacctgcgggtggagagggccatcaccgaggcctccccagcgcactga

KEGG   Homo sapiens (human): 9536
Entry
9536              CDS       T01001                                 

Symbol
PTGES, MGST-IV, MGST1-L1, MGST1L1, MPGES, PGES, PIG12, PP102, PP1294, TP53I12, mPGES-1
Name
(RefSeq) prostaglandin E synthase
  KO
K15729  microsomal prostaglandin-E synthase 1 [EC:5.3.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Drug target
Aceclofenac: D01545
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    9536 (PTGES)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.3  prostaglandin-E synthase
     9536 (PTGES)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 9536
NCBI-ProteinID: NP_004869
OMIM: 605172
HGNC: 9599
Ensembl: ENSG00000148344
Vega: OTTHUMG00000020791
Pharos: O14684(Tchem)
UniProt: O14684
Structure
PDB: 

Position
9q34.11
AA seq 152 aa
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
NT seq 459 nt   +upstreamnt  +downstreamnt
atgcctgcccacagcctggtgatgagcagcccggccctcccggccttcctgctctgcagc
acgctgctggtcatcaagatgtacgtggtggccatcatcacgggccaagtgaggctgcgg
aagaaggcctttgccaaccccgaggatgccctgagacacggaggcccccagtattgcagg
agcgaccccgacgtggaacgctgcctcagggcccaccggaacgacatggagaccatctac
cccttccttttcctgggcttcgtctactcctttctgggtcctaacccttttgtcgcctgg
atgcacttcctggtcttcctcgtgggccgtgtggcacacaccgtggcctacctggggaag
ctgcgggcacccatccgctccgtgacctacaccctggcccagctcccctgcgcctccatg
gctctgcagatcctctgggaagcggcccgccacctgtga

DBGET integrated database retrieval system