KEGG   Homo sapiens (human): 10743Help
Entry
10743             CDS       T01001                                 

Gene name
RAI1, SMCR, SMS
Definition
(RefSeq) retinoic acid induced 1
  KO
K19749  retinoic acid-induced protein 1
Organism
hsa  Homo sapiens (human)
Disease
H01791  Smith-Magenis syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10743 (RAI1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4HisCys3 PHD fingers
    10743 (RAI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 10743
NCBI-ProteinID: NP_109590
OMIM: 607642
HGNC: 9834
Ensembl: ENSG00000108557
Vega: OTTHUMG00000059314
Pharos: Q7Z5J4(Tbio)
UniProt: Q7Z5J4
Position
17p11.2
AA seq 1906 aa AA seqDB search
MQSFRERCGFHGKQQNYQQTSQETSRLENYRQPSQAGLSCDRQRLLAKDYYNPQPYPSYE
GGAGTPSGTAAAVAADKYHRGSKALPTQQGLQGRPAFPGYGVQDSSPYPGRYAGEESLQA
WGAPQPPPPQPQPLPAGVAKYDENLMKKTAVPPSRQYAEQGAQVPFRTHSLHVQQPPPPQ
QPLAYPKLQRQKLQNDIASPLPFPQGTHFPQHSQSFPTSSTYSSSVQGGGQGAHSYKSCT
APTAQPHDRPLTASSSLAPGQRVQNLHAYQSGRLSYDQQQQQQQQQQQQQQALQSRHHAQ
ETLHYQNLAKYQHYGQQGQGYCQPDAAVRTPEQYYQTFSPSSSHSPARSVGRSPSYSSTP
SPLMPNLENFPYSQQPLSTGAFPAGITDHSHFMPLLNPSPTDATSSVDTQAGNCKPLQKD
KLPENLLSDLSLQSLTALTSQVENISNTVQQLLLSKAAVPQKKGVKNLVSRTPEQHKSQH
CSPEGSGYSAEPAGTPLSEPPSSTPQSTHAEPQEADYLSGSEDPLERSFLYCNQARGSPA
RVNSNSKAKPESVSTCSVTSPDDMSTKSDDSFQSLHGSLPLDSFSKFVAGERDCPRLLLS
ALAQEDLASEILGLQEAIGEKADKAWAEAPSLVKDSSKPPFSLENHSACLDSVAKSAWPR
PGEPEALPDSLQLDKGGNAKDFSPGLFEDPSVAFATPDPKKTTGPLSFGTKPTLGVPAPD
PTTAAFDCFPDTTAASSADSANPFAWPEENLGDACPRWGLHPGELTKGLEQGGKASDGIS
KGDTHEASACLGFQEEDPPGEKVASLPGDFKQEEVGGVKEEAGGLLQCPEVAKADRWLED
SRHCCSTADFGDLPLLPPTSRKEDLEAEEEYSSLCELLGSPEQRPGMQDPLSPKAPLICT
KEEVEEVLDSKAGWGSPCHLSGESVILLGPTVGTESKVQSWFESSLSHMKPGEEGPDGER
APGDSTTSDASLAQKPNKPAVPEAPIAKKEPVPRGKSLRSRRVHRGLPEAEDSPCRAPVL
PKDLLLPESCTGPPQGQMEGAGAPGRGASEGLPRMCTRSLTALSEPRTPGPPGLTTTPAP
PDKLGGKQRAAFKSGKRVGKPSPKAASSPSNPAALPVASDSSPMGSKTKETDSPSTPGKD
QRSMILRSRTKTQEIFHSKRRRPSEGRLPNCRATKKLLDNSHLPATFKVSSSPQKEGRVS
QRARVPKPGAGSKLSDRPLHALKRKSAFMAPVPTKKRNLVLRSRSSSSSNASGNGGDGKE
ERPEGSPTLFKRMSSPKKAKPTKGNGEPATKLPPPETPDACLKLASRAAFQGAMKTKVLP
PRKGRGLKLEAIVQKITSPSLKKFACKAPGASPGNPLSPSLSDKDRGLKGAGGSPVGVEE
GLVNVGTGQKLPTSGADPLCRNPTNRSLKGKLMNSKKLSSTDCFKTEAFTSPEALQPGGT
ALAPKKRSRKGRAGAHGLSKGPLEKRPYLGPALLLTPRDRASGTQGASEDNSGGGGKKPK
MEELGLASQPPEGRPCQPQTRAQKQPGHTNYSSYSKRKRLTRGRAKNTTSSPCKGRAKRR
RQQQVLPLDPAEPEIRLKYISSCKRLRSDSRTPAFSPFVRVEKRDAFTTICTVVNSPGDA
PKPHRKPSSSASSSSSSSSFSLDAAGASLATLPGGSILQPRPSLPLSSTMHLGPVVSKAL
STSCLVCCLCQNPANFKDLGDLCGPYYPEHCLPKKKPKLKEKVRPEGTCEEASLPLERTL
KGPECAAAATAGKPPRPDGPADPAKQGPLRTSARGLSRRLQSCYCCDGREDGGEEAAPAD
KGRKHECSKEAPAEPGGEAQEHWVHEACAVWTGGVYLVAGKLFGLQEAMKVAVDMMCSSC
QEAGATIGCCHKGCLHTYHYPCASDAGCIFIEENFSLKCPKHKRLP
NT seq 5721 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcttttcgagaaaggtgtggtttccatggcaaacaacagaactaccagcagacc
tcgcaggaaacatcacgcctagagaattacaggcagccgagtcaggccgggctaagctgc
gaccggcagcggctgctcgccaaggactattataacccgcagccttacccgagctatgag
ggtggcgctggcacgccctctggcactgcagccgcggtggccgccgacaagtaccaccga
ggcagcaaggccctgcccacacagcaaggcctgcaggggaggccggctttccctggctac
ggcgtccaggacagcagcccctacccaggccgctatgctggtgaggagagccttcaggct
tggggggccccacagccaccacccccacagccgcagccactacctgcaggggtggccaag
tatgatgagaacttgatgaaaaagacagcagtgccccccagcaggcagtatgcagagcag
ggcgcccaggtgccctttcggactcactccctgcacgtccagcagccaccgccgccccag
cagcccctggcataccccaagctccaaaggcagaagctgcagaacgacattgcctcccct
ctgcccttcccccagggtacccactttcctcagcattcccagtccttccccacctcctcc
acctactcctcctctgtccagggtggtgggcagggggcccactcctataagagttgcaca
gcaccgactgcccagccccatgacaggccgctgactgccagctccagcctggccccgggg
cagcgggtccagaatcttcatgcctaccagtcgggccgcctcagctatgaccagcagcag
cagcagcagcagcagcagcagcagcagcagcaagcccttcagagccggcaccatgcccag
gaaaccctccattaccaaaacctcgccaagtatcagcactacgggcagcaaggccagggc
tactgccagccggacgcagccgtccggaccccagagcagtactaccagaccttcagcccc
agctccagccactcacccgcccgctccgtgggccgctcaccttcctacagttccacaccg
tcgccgctgatgccaaacctggagaactttccctacagccagcagccgctcagcaccggg
gccttccccgcagggatcactgaccacagccacttcatgcccctgctcaatccctcccca
acggatgccaccagctctgtggacacccaggctggcaactgcaagccccttcagaaggac
aagctccctgagaacctgctgtcggatctcagcctgcagagcctcacggcgctgacctca
caggtggagaacatctccaacaccgtccagcagctgctgctctccaaggctgctgtgccg
cagaagaaaggtgtcaagaacctcgtgtccaggaccccagagcagcataaaagccagcac
tgcagccccgaagggagcggctactcagccgagcccgcaggcacaccgctgtcagagccg
ccgagcagcacgccacagtccacgcatgcggagccgcaggaggccgactacctgagcggc
tccgaggacccactggagcgcagcttcctctactgcaaccaggcccgtggcagccctgcc
agggtcaacagcaactcgaaggccaagcccgagtccgtgtccacctgttctgtgacctct
cctgacgacatgtccaccaaatctgacgactccttccagagcctacacggcagtctgccg
ctcgacagcttctccaagttcgtggcgggtgagcgggactgtccgcggctgctgctcagc
gccctggcacaggaggacctggcctccgagatcctggggctgcaggaagccatcggtgag
aaggccgacaaagcttgggctgaagcacccagcctggtcaaggacagcagcaagccaccc
ttctcgctggagaaccacagcgcctgcctggactctgtggccaagagtgcgtggccccgg
cctggggagccggaggccctgcccgactccttgcagctggacaagggcggcaatgccaag
gacttcagcccagggctgtttgaagacccttccgtggccttcgctacgcctgaccccaaa
aagacaactggtcctctctcctttggtaccaagcccacccttggggttcctgctccagac
cccactacagcagcttttgactgtttcccggacacaaccgctgccagctcagcggacagc
gccaacccctttgcctggccagaggaaaacctgggggatgcttgtcccaggtggggattg
caccctggcgagcttaccaagggcctggagcagggtgggaaggcctcagatggcatcagc
aaaggggacacccatgaggcttcggcctgcctgggcttccaggaggaggacccccctggg
gagaaggtggcctcgttgcccggggacttcaagcaggaggaggtgggtggggtgaaggag
gaggcaggtgggctgctgcagtgccccgaggtggccaaggctgaccggtggctggaggac
agccggcactgctgttccaccgccgacttcggggacctcccactgctgccacccaccagc
aggaaggaggacctggaagctgaggaggagtactcctccctatgtgagctcctgggcagc
cccgagcagaggcctggcatgcaggacccgctgtcacccaaggccccactcatctgcacc
aaggaggaggtggaggaggtgctggactccaaggccggctggggctctccgtgccacctc
tcaggggagtccgtcatcctgctgggccctacagtgggcaccgagtcaaaggtccagagc
tggtttgagtcctctctgtcacacatgaagccaggtgaagaggggcctgatggggagcga
gctccaggggattccaccacctcggacgcctctctggcccagaagcccaacaagcctgct
gtgcccgaggcgcccatcgcaaagaaagagcctgtgccacggggcaaaagcttacggagc
cgtcgggtgcaccgggggctgcccgaggccgaggactccccatgcagggcaccagtgctg
cccaaagacctcttgctccctgaatcctgcacagggcccccccagggacagatggaaggg
gctggagccccaggccggggggcctcggaagggctccccaggatgtgtactcgttctctc
acggccctgagtgagccccgcacgcccggacccccaggcctgaccaccacccctgcaccc
ccagacaaactggggggcaagcagcgagccgccttcaagtcgggcaagcgggtggggaag
ccctcacccaaggctgcctccagccccagcaacccggccgccctgcctgtggcctccgac
agcagcccgatgggctccaagaccaaggagacagactcacccagcacgcctggcaaggac
cagcgctccatgatccttcggtcacgcaccaaaacccaggagatcttccactccaagcgg
cggaggccctctgagggccggctccccaactgccgtgccaccaagaagctcctcgacaac
agccacttgcccgccacattcaaggtctccagcagcccccagaaggagggcagggtgagc
cagcgggcaagggtccccaaacctggtgcaggcagcaagctctctgaccggcccctccat
gcgctcaaaaggaagtcggccttcatggcgccggtccccaccaagaagcggaacctggtc
ttgcggagccgcagcagcagcagcagcaacgccagtggcaatgggggagatgggaaggag
gagaggcctgagggttcccccaccctcttcaagaggatgtcttctcccaagaaagccaag
cccaccaagggcaatggcgagcctgccacaaagctcccacccccggagacccccgatgcc
tgcctcaagctcgcctctcgggcagccttccagggggccatgaagaccaaggtgctgcca
ccccggaagggccggggcctgaagctggaagccatcgtgcagaagatcacctcgcccagc
ctcaagaagttcgcatgtaaagcgccaggggcctctcctggtaatcctctgagcccatcc
ctttccgacaaagaccgtgggctcaagggtgctgggggcagcccagtgggggtggaagaa
ggcctggtaaatgtgggcaccgggcagaagctcccaacttctggggctgatccgttatgc
agaaatccaaccaacagatccttaaaaggcaaactcatgaacagtaagaaactgtcttct
actgactgtttcaaaaccgaggccttcacatccccggaggccctgcagcctggggggact
gccctggcgcctaagaagaggagccggaaaggccgggcaggggcccatggactctccaaa
ggcccgctggagaagcggccctatcttggcccggctctgctcctgactccccgagacagg
gccagtggcacacaaggggccagtgaggacaactctggtggaggaggcaagaagccaaag
atggaggagctgggcctggcctcccagcccccggagggcaggccctgccagccccagaca
agggcacagaaacagccaggccacaccaactacagcagctattccaagcggaagcgcctc
actcggggccgggccaagaacaccacctcttcaccctgtaaggggcgtgccaagcgacga
cgacagcagcaggtgctgcccctggatcccgcagagcctgaaatccgcctcaagtacatt
tcctcttgcaagcggctgaggtcagacagccggacccccgccttctcacccttcgtgcgg
gtggagaagcgagacgcgttcaccaccatatgcactgttgtcaactcccctggagatgcg
cccaagccccacaggaagccttcctcctctgcctcctcttcctcatcctcgtcctcgttc
tccttggatgcagccggggcctccctggccacactccctggaggctccatcctgcagccg
cggccctccttgcccctctcctccacgatgcacttggggcctgtggtttccaaggccctg
agtacctcttgccttgtttgctgcctctgccaaaacccggccaacttcaaggaccttggg
gacctctgtgggccctactaccctgaacactgcctccccaaaaagaagccaaaactcaag
gagaaggtgcggccagaaggcacctgtgaggaggcctcgctgccgcttgagagaacactc
aaaggtcccgagtgtgcagctgccgccactgccgggaagccccccaggcctgacggccca
gctgacccggccaagcagggcccactgcgcaccagtgcccggggcctgtcccggaggctg
cagagctgctactgctgtgatggccgggaggatgggggcgaggaggcagccccagccgac
aagggtcgcaaacatgagtgcagcaaggaggctccggcagagcccggcggggaggcccag
gagcactgggtgcatgaggcctgtgccgtgtggaccggcggcgtctacctggtggccggg
aagctctttgggctgcaggaggccatgaaggtggccgtggacatgatgtgttccagctgc
caagaagccggggccaccattgggtgctgccacaaaggatgcctccacacctaccactac
ccgtgtgccagcgatgcaggttgcatattcatcgaagagaacttttctttgaaatgtccc
aaacataagaggctgccgtag

DBGET integrated database retrieval system