KEGG   Homo sapiens (human): 10744
Entry
10744             CDS       T01001                                 

Gene name
PTTG2
Definition
(RefSeq) pituitary tumor-transforming 2
  KO
K06635  securin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10744 (PTTG2)
   04114 Oocyte meiosis
    10744 (PTTG2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    10744 (PTTG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10744 (PTTG2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Securin
    10744 (PTTG2)
SSDB
Motif
Pfam: Securin
Other DBs
NCBI-GeneID: 10744
NCBI-ProteinID: NP_006598
OMIM: 604231
HGNC: 9691
Ensembl: ENSG00000250254
Vega: OTTHUMG00000160424
Pharos: Q9NZH5(Tdark)
UniProt: Q9NZH5
Position
4p14
AA seq 191 aa
MATLIYVDKEIGEPGTRVAAKDVLKLESRPSIKALDGISQVLTRRFGKTYDAPSALPKAT
RKALGTVNRATEKSVKTNGPRKQKQPSFSAKKMTEKTVKTKSSVPASDDAYPEIEKFFPF
NLLDFESFDLPEERQIAHLPLSGVPLMILDEEGELEKLFQLGPPSPVKMPSPPWECNLFA
VSFKHSVDPGC
NT seq 576 nt   +upstreamnt  +downstreamnt
atggctactctgatctacgttgataaggaaattggagaaccaggcacccgtgtggctgcc
aaggatgtgctgaagctggagtctagaccttcaatcaaagcattagatgggatatctcaa
gttttaacacgacgttttggcaaaacatacgatgctccatcagccttacctaaagctacc
agaaaggctttgggcactgtcaacagagctacagaaaagtcagtaaagaccaatggaccc
agaaaacaaaaacagccaagcttttctgccaaaaagatgaccgagaagactgttaaaaca
aaaagttctgttcctgcctcagatgacgcctatccagaaatagaaaaattctttcccttc
aatcttctagactttgagagttttgacctgcctgaagagcgccagattgcacacctcccc
ttgagtggagtgcctctcatgatccttgatgaggagggagagcttgaaaagctgtttcag
ctgggccccccttcacctgtgaaaatgccctctccaccatgggaatgcaatctgtttgca
gtctccttcaagcattctgtcgaccctggatgttga

DBGET integrated database retrieval system