KEGG   Homo sapiens (human): 10750Help
Entry
10750             CDS       T01001                                 

Gene name
GRAP
Definition
(RefSeq) GRB2 related adaptor protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH2_2
Motif
Other DBs
NCBI-GeneID: 10750
NCBI-ProteinID: NP_006604
OMIM: 604330
HGNC: 4562
Ensembl: ENSG00000154016
Vega: OTTHUMG00000059436
Pharos: Q13588(Tbio)
UniProt: Q13588
Position
17p11.2
AA seq 217 aa AA seqDB search
MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPW
YSGRISRQLAEEILMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFL
WEEKFNSLNELVDFYRTTTIAKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFR
RGDIIEVLERPDPHWWRGRSCGRVGFFPRSYVQPVHL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgtggccctgtacagctttcaggctacagagagcgacgagctggccttcaac
aagggagacacactcaagatcctgaacatggaggatgaccagaactggtacaaggccgag
ctccggggtgtcgagggatttattcccaagaactacatccgcgtcaagccccatccgtgg
tactcgggcaggatttcccggcagctggccgaagagattctgatgaagcggaaccatctg
ggagccttcctgatccgggagagtgagagctccccaggggagttctctgtgtctgtgaac
tatggagaccaggtgcagcacttcaaggtgctgcgtgaggcctcggggaagtacttcctg
tgggaggagaagttcaactccctcaacgagctggtcgacttctaccgcaccaccaccatc
gccaagaagcggcagatcttcctgcgcgacgaggagcccttgctcaagtcacctggggcc
tgctttgcccaggcccagtttgacttctcagcccaggacccctcgcagctcagcttccgc
cgtggcgacatcattgaggtcctggagcgcccagacccccactggtggcggggccggtcc
tgcgggcgcgttggcttcttcccacggagttacgtgcagcccgtgcacctgtga

DBGET integrated database retrieval system