KEGG   Homo sapiens (human): 10753
Entry
10753             CDS       T01001                                 

Gene name
CAPN9, GC36, nCL-4
Definition
(RefSeq) calpain 9
  KO
K08578  calpain-9 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10753 (CAPN9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     10753 (CAPN9)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C2: calpain family
   10753 (CAPN9)
SSDB
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_7 Ndufs5 EF-hand_5
Other DBs
NCBI-GeneID: 10753
NCBI-ProteinID: NP_006606
OMIM: 606401
HGNC: 1486
Ensembl: ENSG00000135773
Vega: OTTHUMG00000037779
Pharos: O14815(Tbio)
UniProt: O14815 Q6PIV8
Structure
PDB: 
1ZIV 2P0R

Position
1q42.2
AA seq 690 aa
MPYLYRAPGPQAHPVPKDARITHSSGQSFEQMRQECLQRGTLFEDADFPASNSSLFYSER
PQIPFVWKRPGEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQD
QSFGPGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKL
NGSYEALKGGSAIEAMEDFTGGVAETFQTKEAPENFYEILEKALKRGSLLGCFIDTRSAA
ESEARTPFGLIKGHAYSVTGIDQVSFRGQRIELIRIRNPWGQVEWNGSWSDSSPEWRSVG
PAEQKRLCHTALDDGEFWMAFKDFKAHFDKVEICNLTPDALEEDAIHKWEVTVHQGSWVR
GSTAGGCRNFLDTFWTNPQIKLSLTEKDEGQEECSFLVALMQKDRRKLKRFGANVLTIGY
AIYECPDKDEHLNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEAD
FCLRIFSEKKAITRDMDGNVDIDLPEPPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAE
ELEYVLNAVLQKKKDIKFKKLSLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLF
LRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLEN
ASRVFQALSTKNKEFIHLNINEFIHLTMNI
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgccttacctctaccgggccccagggcctcaggcacacccggttcccaaggacgcccgg
atcacccactcctcaggccagagctttgagcaaatgaggcaggagtgcctgcagagaggc
accctgtttgaggatgcagacttcccagccagcaattcctccctgttctacagtgagagg
ccgcagatcccctttgtgtggaaacgaccaggggaaatcgtgaaaaacccagaattcatt
cttggaggggccaccaggactgatatctgccagggagagctgggagactgctggctatta
gccgccatcgcctcccttacgcttaatcaaaaagcactggccagagtcatcccccaggac
caaagctttggccctggttatgccgggatattccatttccagttctggcagcacagtgag
tggctggacgtggtgatcgatgaccgcctgcccaccttcagggaccgcttggttttcctc
cactctgccgaccacaacgagttctggagcgccttgctggaaaaagcctacgccaagcta
aatgggagctatgaagctctgaagggaggcagcgccatcgaggccatggaagacttcact
gggggtgtggcagagaccttccaaactaaagaggcccccgagaacttctatgagattcta
gagaaggctttgaagagaggctccctgctgggctgcttcattgataccagaagtgctgca
gaatctgaggcccggacgccgtttggtcttattaagggtcatgcctacagtgtaacggga
attgaccaggtaagcttccgaggccagagaatcgagctcatccgaatccggaacccttgg
ggccaggttgagtggaacgggtcgtggagcgacagttctccggagtggcgttctgttggt
ccagctgagcagaagcgtctgtgtcacactgctctggatgatggggaattctggatggca
tttaaggacttcaaggcccactttgataaagtggagatctgcaacctcactcccgatgcc
ctggaggaagacgcgatccacaaatgggaggtgacggtccatcagggaagctgggttcgc
ggctccacggctgggggctgccgcaatttcctggataccttttggaccaatccacaaata
aaattgtctctgactgagaaagatgaggggcaggaggagtgtagtttccttgtagccctg
atgcagaaagatagaaggaaactcaagagatttggtgccaatgtgctgacaatcggctat
gccatttatgagtgccctgacaaagacgaacacctgaacaaagacttcttcagataccac
gcttctcgggccagaagcaagacgttcatcaacctgagagaagtctccgaccggttcaag
ctgccccctggggagtacatcctgattcccagcacttttgagccccaccaggaagctgat
ttctgtctgagaatcttttcagagaaaaaagccattacccgggatatggatggaaatgta
gacattgaccttcctgagcctccaaagccaactccacctgaccaggagacagaggaggag
cagcggtttcgggctctgtttgaacaagtcgctggtgaggacatggaggtgacagcagag
gaacttgagtatgttttaaatgctgtgctgcaaaagaaaaaggacatcaaattcaagaag
ctaagcctgatctcctgtaaaaacatcatttccctgatggacaccagcggcaatgggaag
ctggagtttgatgaattcaaagtgttctgggacaagctgaagcagtggattaaccttttc
cttcggtttgatgctgacaagtccggcaccatgtctacctatgaactacggactgcactg
aaagctgcaggctttcagctgagcagccacctcctgcagctgattgtgctcaggtatgcg
gatgaggagctccagctggacttcgatgacttcctcaactgcctggtccggctggagaat
gcgagccgggtgttccaggctctcagtacaaagaacaaggagttcattcatctcaatata
aatgagttcatccatttgacaatgaacatctga

DBGET integrated database retrieval system