KEGG   Homo sapiens (human): 10755
Entry
10755             CDS       T01001                                 
Symbol
GIPC1, C19orf3, GIPC, GLUT1CBP, Hs.6454, IIP-1, NIP, OPDM2, RGS19IP1, SEMCAP, SYNECTIIN, SYNECTIN, TIP-2
Name
(RefSeq) GIPC PDZ domain containing family member 1
  KO
K20056  PDZ domain-containing protein GIPC
Organism
hsa  Homo sapiens (human)
Disease
H02513  Oculopharyngodistal myopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10755 (GIPC1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    10755 (GIPC1)
SSDB
Motif
Pfam: PDZ PDZ_6 DDR PyrI
Other DBs
NCBI-GeneID: 10755
NCBI-ProteinID: NP_005707
OMIM: 605072
HGNC: 1226
Ensembl: ENSG00000123159
Pharos: O14908(Tbio)
UniProt: O14908 A0A024R7I0
Position
19:complement(14477762..14496127)
AA seq 333 aa
MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVF
HTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLE
DFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEA
INGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGRPGSGPQLGTGR
GTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDEL
AEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgccgctgggactggggcggcggaaaaaggcgccccctctagtggaaaatgaggaggct
gagccaggccgtggagggctgggcgtgggggagccagggcctctgggcggaggtgggtcg
gggggcccccaaatgggcttgcccccccctcccccagccctgcggccccgcctcgtgttc
cacacccagctggcccatggcagtcccactggccgcatcgagggcttcaccaacgtcaag
gagctgtatggcaagatcgccgaggccttccgcctgccaactgccgaggtgatgttctgc
accctgaacacccacaaagtggacatggacaagctcctggggggccagatcgggctggag
gacttcatcttcgcccacgtgaaggggcagcgcaaggaggtggaggtgttcaagtcggag
gatgcactcgggctcaccatcacggacaacggggctggctacgccttcatcaagcgcatc
aaggagggcagcgtgatcgaccacatccacctcatcagcgtgggcgacatgatcgaggcc
attaacgggcagagcctgctgggctgccggcactacgaggtggcccggctgctcaaggag
ctgccccgaggccgtaccttcacgctgaagctcacggagcctcgcaaggccttcgacatg
atcagccagcgttcagcgggtggccgccctggctctggcccacaactgggcactggccga
gggaccctgcggctccgatcccggggccccgccacggtggaggatctgccctctgccttt
gaagagaaggccattgagaaggtggatgacctgctggagagttacatgggtatcagggac
acggagctggcggccaccatggtggagctgggaaaggacaaaaggaacccggatgagctg
gccgaggccctggacgaacggctgggtgactttgccttccctgacgagttcgtctttgac
gtctggggcgccattggggacgccaaggtcggccgctactag

DBGET integrated database retrieval system