KEGG   Homo sapiens (human): 10763Help
Entry
10763             CDS       T01001                                 

Gene name
NES, Nbla00170
Definition
(RefSeq) nestin
  KO
K07609  nestin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10763 (NES)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type VI
     10763 (NES)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament
Motif
Other DBs
NCBI-GeneID: 10763
NCBI-ProteinID: NP_006608
OMIM: 600915
HGNC: 7756
Ensembl: ENSG00000132688
Vega: OTTHUMG00000034299
Pharos: P48681(Tbio)
UniProt: P48681 Q9H6U9
Position
1q23.1
AA seq 1621 aa AA seqDB search
MEGCMGEESFQMWELNRRLEAYLARVKALEEQNELLSAELGGLRAQSADTSWRAHADDEL
AALRALVDQRWREKHAAEVARDNLAEELEGVAGRCQQLRLARERTTEEVARNRRAVEAEK
CARAWLSSQVAELERELEALRVAHEEERVGLNAQAACAPRCPAPPRGPPAPAPEVEELAR
RLGEAWRGAVRGYQERVAHMETSLGQARERLGRAVQGAREGRLELQQLQAERGGLLERRA
ALEQRLEGRWQERLRATEKFQLAVEALEQEKQGLQSQIAQVLEGRQQLAHLKMSLSLEVA
TYRTLLEAENSRLQTPGGGSKTSLSFQDPKLELQFPRTPEGRRLGSLLPVLSPTSLPSPL
PATLETPVPAFLKNQEFLQARTPTLASTPIPPTPQAPSPAVDAEIRAQDAPLSLLQTQGG
RKQAPEPLRAEARVAIPASVLPGPEEPGGQRQEASTGQSPEDHASLAPPLSPDHSSLEAK
DGESGGSRVFSICRGEGEGQIWGLVEKETAIEGKVVSSLQQEIWEEEDLNRKEIQDSQVP
LEKETLKSLGEEIQESLKTLENQSHETLERENQECPRSLEEDLETLKSLEKENKELLKDV
EVVRPLEKEAVGQLKPTGKEDTQTLQSLQKENQELMKSLEGNLETFLFPGTENQELVSSL
QENLESLTALEKENQEPLRSPEVGDEEALRPLTKENQEPLRSLEDENKEAFRSLEKENQE
PLKTLEEEDQSIVRPLETENHKSLRSLEEQDQETLRTLEKETQQRRRSLGEQDQMTLRPP
EKVDLEPLKSLDQEIARPLENENQEFLKSLKEESVEAVKSLETEILESLKSAGQENLETL
KSPETQAPLWTPEEINQGAMNPLEKEIQEPLESVEVNQETFRLLEEENQESLRSLGAWNL
ENLRSPEEVDKESQRNLEEEENLGKGEYQESLRSLEEEGQELPQSADVQRWEDTVEKDQE
LAQESPPGMAGVENEDEAELNLREQDGFTGKEEVVEQGELNATEEVWIPGEGHPESPEPK
EQRGLVEGASVKGGAEGLQDPEGQSQQVGAPGLQAPQGLPEAIEPLVEDDVAPGGDQASP
EVMLGSEPAMGESAAGAEPGPGQGVGGLGDPGHLTREEVMEPPLEEESLEAKRVQGLEGP
RKDLEEAGGLGTEFSELPGKSRDPWEPPREGREESEAEAPRGAEEAFPAETLGHTGSDAP
SPWPLGSEEAEEDVPPVLVSPSPTYTPILEDAPGPQPQAEGSQEASWGVQGRAEALGKVE
SEQEELGSGEIPEGPQEEGEESREESEEDELGETLPDSTPLGFYLRSPTSPRWDPTGEQR
PPPQGETGKEGWDPAVLASEGLEAPPSEKEEGEEGEEECGRDSDLSEEFEDLGTEAPFLP
GVPGEVAEPLGQVPQLLLDPAAWDRDGESDGFADEEESGEEGEEDQEEGREPGAGRWGPG
SSVGSLQALSSSQRGEFLESDSVSVSVPWDDSLRGAVAGAPKTALETESQDSAEPSGSEE
ESDPVSLEREDKVPGPLEIPSGMEDAGPGADIIGVNGQGPNLEGKSQHVNGGVMNGLEQS
EEVGQGMPLVSEGDRGSPFQEEEGSALKTSWAGAPVHLGQGQFLKFTQREGDRESWSSGE
D
NT seq 4866 nt NT seq  +upstreamnt  +downstreamnt
atggagggctgcatgggggaggagtcgtttcagatgtgggagctcaatcggcgcctggag
gcctacctggcccgggtcaaggcgctggaggagcagaatgagctgctcagcgcggagctc
ggggggctccgggcacaatccgcggacacctcctggcgggcgcatgccgacgacgagctg
gcggccctgcgggccctcgttgaccaacgctggcgggagaagcacgcggccgaggtggcg
cgcgacaacctggctgaagagctggagggcgtggcaggccgatgccagcagctgcggctg
gcccgggagcggacgacggaggaggtagcccgcaaccggcgcgccgtcgaggcagagaaa
tgcgcccgggcctggctgagtagccaggtggcagagctggagcgcgagctagaggctcta
cgcgtggcgcacgaggaggagcgcgtcggcctgaacgcgcaggctgcctgtgccccccgc
tgccccgcgccgccccgcgggcctcccgcgccggccccggaggtagaggagctggcaagg
cgactgggcgaggcgtggcgcggggcagtgcgcggctaccaggagcgcgtggcacacatg
gagacgtcgctgggccaggcccgcgagcggctgggccgggcggtgcagggtgcccgcgag
ggccgcctggagctgcagcagctccaggctgagcgcggaggcctcctggagcgcagggca
gcgttggaacagaggttggagggccgctggcaggagcggctgcgggctactgaaaagttc
cagctggctgtggaggccctggagcaggagaaacagggcctacagagccagatcgctcag
gtcctggaaggtcggcagcagctggcgcacctcaagatgtccctcagcctggaggtggcc
acgtacaggaccctcctggaggctgagaactcccggctgcaaacacctggcggtggctcc
aagacttccctcagctttcaggaccccaagctggagctgcaattccctaggaccccagag
ggccggcgtcttggatctttgctcccagtcctgagcccaacttccctcccctcacccttg
cctgctacccttgagacacctgtgccagcctttcttaagaaccaagaattcctccaggcc
cgtacccctaccttggccagcacccccatcccccccacacctcaggcaccctctcctgct
gtagatgcagagatcagagcccaggatgctcctctctctctgctccagacacagggtggg
aggaaacaggctccagagcccctgcgggctgaagccagggtggccattcctgccagcgtc
ctgcctggaccagaggagcctgggggccagcggcaagaggccagtacaggccagtcccca
gaggaccatgcctccttggcaccacccctcagccctgaccactccagtttagaggctaag
gatggagaatccggtgggtctagagtgttcagcatatgccgaggggaaggtgaagggcaa
atctgggggttggtagagaaagaaacagccatagagggcaaagtggtaagcagcttgcag
caggaaatatgggaagaagaggatctaaacaggaaggaaatccaggactcccaggttcct
ttggaaaaagaaaccctgaagtctctgggagaggagattcaagagtcactgaagactctg
gaaaaccagagccatgagacactagaaagggagaatcaagaatgtccgaggtctttagaa
gaagacttagaaacactaaaaagtctagaaaaggaaaataaagagctattaaaggatgtg
gaggtagtgagacctctagaaaaagaggctgtaggccaacttaagcctacaggaaaagag
gacacacagacattgcaatccctgcaaaaggagaatcaagaactaatgaaatctcttgaa
ggtaatctagagacatttttatttccaggaacggaaaatcaagaattagtaagttctctg
caagagaacttagagtcattgacagctctggaaaaggagaatcaagagccactgagatct
ccagaagtaggggatgaggaggcactgagacctctgacaaaggagaatcaggaacccctg
aggtctcttgaagatgagaacaaagaggcctttagatctctagaaaaagagaaccaggag
ccactgaagactctagaagaagaggaccagagtattgtgagacctctagaaacagagaat
cacaaatcactgaggtctttagaagaacaggaccaagagacattgagaactcttgaaaaa
gagactcaacagcgacggaggtctctaggggaacaggatcagatgacattaagaccccca
gaaaaagtggatctagaaccactgaagtctcttgaccaggagatagctagacctcttgaa
aatgagaatcaagagttcttaaagtcactcaaagaagagagcgtagaggcagtaaaatct
ttagaaacagagatcctagaatcactgaagtctgcgggacaagagaacctggaaacactg
aaatctccagaaactcaagcaccactgtggactccagaagaaataaatcagggggcaatg
aatcctctagaaaaggaaattcaagaaccactggagtctgtggaagtgaaccaagagaca
ttcagactcctggaagaggagaatcaggaatcattgagatctctgggagcatggaacctg
gagaatttgagatctccagaggaggtagacaaggaaagtcaaaggaatctggaagaggaa
gagaacctgggaaagggagagtaccaagagtcactgaggtctctggaggaggagggacag
gagctgccgcagtctgcagatgtgcagaggtgggaagatacggtggagaaggaccaagaa
ctggctcaggaaagccctcctgggatggctggagtggaaaatgaggatgaggcagagctg
aatctgagggagcaggatggcttcactgggaaggaggaggtggtagagcagggagagctg
aatgccacagaggaggtctggatcccaggcgaggggcacccagagagccctgagcccaaa
gagcagagaggcctggttgagggagccagtgtgaagggaggggctgagggcctccaggac
cctgaagggcaatcacaacaggtgggggccccaggcctccaggctccccaggggctgcca
gaggcgatagagcccctggtggaagatgatgtggccccagggggtgaccaagcctcccca
gaggtcatgttggggtcagagcctgccatgggtgagtctgctgcgggagctgagccaggc
ccggggcagggggtgggagggctgggggacccaggccatctgaccagggaagaggtgatg
gaaccacccctggaagaggagagtttggaggcaaagagggttcagggcttggaagggcct
agaaaggacctagaggaggcaggtggtctggggacagagttctccgagctgcctgggaag
agcagagacccttgggagcctcccagggagggtagggaggagtcagaggctgaggccccc
aggggagcagaggaggcgttccctgctgagaccctgggccacactggaagtgatgcccct
tcaccttggcctctggggtcagaggaagctgaggaggatgtaccaccagtgctggtctcc
cccagcccaacgtacaccccgatcctggaagatgcccctgggcctcagcctcaggctgaa
gggagtcaggaggctagctggggggtgcaggggagggctgaagccctggggaaagtagag
agcgagcaggaggagttgggttctggggagatccccgagggcccccaggaggaaggggag
gagagcagagaagagagcgaggaggatgagctcggggagacccttccagactccactccc
ctgggcttctacctcaggtcccccacctcccccaggtgggaccccactggagagcagagg
ccaccccctcaaggggagactggaaaggagggctgggatcctgctgtcctggcttccgag
ggccttgaggccccaccctcagaaaaggaggagggggaggagggagaagaggagtgtggc
cgtgactctgacctgtcagaagaatttgaggacctggggactgaggcaccttttcttcct
ggggtccctggggaggtggcagaacctctgggccaggtgccccagctgctactggatcct
gcagcctgggatcgagatggggagtccgatgggtttgcagatgaggaagaaagtggggag
gagggagaggaggatcaggaggaggggagggagccaggggctgggcggtgggggccaggg
tcttctgttggcagcctccaggccctgagtagctcccagagaggggaattcctggagtct
gattctgtgagtgtcagtgtcccctgggatgacagcttgaggggtgcagtggctggtgcc
cccaagactgccctggaaacggagtcccaggacagtgctgagccttctggctcagaggaa
gagtctgaccctgtttccttggagagggaggacaaagtccctggccctctagagatcccc
agtgggatggaggatgcaggcccaggggcagacatcattggtgttaatggccagggtccc
aacttggaggggaagtcacagcatgtgaatgggggagtgatgaacgggctggagcagtct
gaggaagtggggcaaggaatgccgctagtctctgagggagaccgagggagcccctttcag
gaggaggaggggagtgctctgaagacctcttgggcaggggctcctgttcacctgggccag
ggtcagttcctgaagttcactcagagggaaggagatagagagtcctggtcctcaggggag
gactag

DBGET integrated database retrieval system