KEGG   Homo sapiens (human): 10765
Entry
10765             CDS       T01001                                 

Gene name
KDM5B, CT31, JARID1B, MRT65, PLU-1, PLU1, PPP1R98, PUT1, RBBP2H1A, RBP2-H1
Definition
(RefSeq) lysine demethylase 5B
  KO
K11446  [histone H3]-trimethyl-L-lysine4 demethylase [EC:1.14.11.67]
Organism
hsa  Homo sapiens (human)
Disease
H00768  Autosomal recessive mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    10765 (KDM5B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10765 (KDM5B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.67  [histone H3]-trimethyl-L-lysine4 demethylase
     10765 (KDM5B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10765 (KDM5B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    10765 (KDM5B)
SSDB
Motif
Pfam: PLU-1 JmjC PHD ARID zf-C5HC2 JmjN PHD_2 zf-PHD-like Lipoprotein_20
Other DBs
NCBI-GeneID: 10765
NCBI-ProteinID: NP_006609
OMIM: 605393
HGNC: 18039
Ensembl: ENSG00000117139
Vega: OTTHUMG00000041401
Pharos: Q9UGL1(Tbio)
UniProt: Q9UGL1
Structure
PDB: 

Position
1q32.1
AA seq 1544 aa
MEAATTLHPGPRPALPLGGPGPLGEFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTG
ICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLNFLDQIAKYWELQGSTLKI
PHVERKILDLFQLNKLVAEEGGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILN
PYNLFLSGDSLRCLQKPNLTTDTKDKEYKPHDIPQRQSVQPSETCPPARRAKRMRAEAMN
IKIEPEETTEARTHNLRRRMGCPTPKCENEKEMKSSIKQEPIERKDYIVENEKEKPKSRS
KKATNAVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQE
CSKPQEAFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEED
VTVEYGADIASKEFGSGFPVRDGKIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADIC
GMKLPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPE
LFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAV
NFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIE
DEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVK
ELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAESYNEWALNVNEALEAKINKKKSLVSFK
ALIEESEMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVN
ELRQFVTQLYALPCVLSQTPLLKDLLNRVEDFQQHSQKLLSEETPSAAELQDLLDVSFEF
DVELPQLAEMRIRLEQARWLEEVQQACLDPSSLTLDDMRRLIDLGVGLAPYSAVEKAMAR
LQELLTVSEHWDDKAKSLLKARPRHSLNSLATAVKEIEEIPAYLPNGAALKDSVQRARDW
LQDVEGLQAGGRVPVLDTLIELVTRGRSIPVHLNSLPRLETLVAEVQAWKECAVNTFLTE
NSPYSLLEVLCPRCDIGLLGLKRKQRKLKEPLPNGKKKSTKLESLSDLERALTESKETAS
AMATLGEARLREMEALQSLRLANEGKLLSPLQDVDIKICLCQKAPAAPMIQCELCRDAFH
TSCVAVPSISQGLRIWLCPHCRRSEKPPLEKILPLLASLQRIRVRLPEGDALRYMIERTV
NWQHRAQQLLSSGNLKFVQDRVGSGLLYSRWQASAGQVSDTNKVSQPPGTTSFSLPDDWD
NRTSYLHSPFSTGRSCIPLHGVSPEVNELLMEAQLLQVSLPEIQELYQTLLAKPSPAQQT
DRSSPVRPSSEKNDCCRGKRDGINSLERKLKRRLEREGLSSERWERVKKMRTPKKKKIKL
SHPKDMNNFKLERERSYELVRSAETHSLPSDTSYSEQEDSEDEDAICPAVSCLQPEGDEV
DWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRCTVKDAPSRK
NT seq 4635 nt   +upstreamnt  +downstreamnt
atggaggcggccaccacactgcacccaggcccgcgcccggcgctgcccctcgggggcccg
ggcccgctgggcgagttcctgcctccacccgagtgcccggtcttcgaacccagctgggaa
gagttcgcggaccccttcgctttcatccacaagatccggcccatagccgagcagactggc
atctgtaaggtgcggccgccgccggattggcagccaccatttgcatgtgatgttgataaa
cttcattttacgccacgtatccagagactgaatgaattggaggcccaaactcgtgtaaaa
ttgaatttcttggaccagattgcaaagtactgggagttacagggaagtactctgaaaatt
ccacatgtggagaggaagatcttggacttatttcagcttaataagttagttgcagaagaa
ggtggatttgcagttgtttgcaaggatagaaaatggaccaaaattgctaccaagatgggg
tttgctcctggcaaagcagtgggctcacatatcagagggcattatgaacgaattctcaac
ccctacaacttattcctgtccggagacagcctaaggtgtttgcagaagccaaacctgacc
acagacactaaggacaaggagtacaaaccccatgatattccccagaggcagtctgtgcag
ccttcggaaacgtgccccccagcccgacgagcaaaacgcatgagagcagaggccatgaat
attaaaatagaacccgaggagacaacggaagccagaactcataatctgagacgtcgaatg
ggttgtccaactccaaaatgtgaaaatgagaaagaaatgaagagtagcatcaagcaagaa
cctattgagaggaaagattatattgtagaaaatgagaaggaaaagcccaagagtcgatct
aaaaaagccaccaatgctgtggacctgtatgtctgtcttttatgtggcagtggcaatgat
gaagaccggctactgttgtgtgatggctgtgatgacagttaccataccttttgcttgatc
ccacctctccatgatgttcccaagggagactggaggtgtcctaagtgtttggctcaggaa
tgtagtaagccacaagaagcatttggctttgaacaagcagccagggactataccctccgt
acttttggggaaatggcagatgcgttcaaatctgattacttcaacatgccagtccatatg
gtccccacagagcttgttgagaaagaattttggagactagtaagcactattgaggaggat
gtcacagtggaatatggagctgacattgcctcaaaggaatttggcagtggctttcctgtc
cgagatgggaaaatcaaactctcacctgaggaagaggagtatcttgatagtggctggaat
ttgaacaacatgccagtgatggagcagtctgtccttgcacatattactgctgatatatgt
ggcatgaaacttccttggttgtatgtgggaatgtgcttttcttcattctgttggcacatt
gaagaccactggagctattcaattaactacttgcactggggtgagccaaaaacctggtat
ggagtcccagggtatgctgctgagcagctagaaaatgtaatgaagaaactagctccagaa
ctctttgtgtcccagccggatctcctccatcagcttgtgaccatcatgaaccccaatacc
ctgatgactcatgaagtgcctgtttaccgaactaatcagtgtgctggggagtttgtgatt
acatttccaagagcctaccacagtggttttaaccagggttttaattttgctgaggctgtt
aacttctgcactgttgattggctgccattaggccgacagtgtgtggagcattatcgcttg
cttcatcgatattgtgtgttttcccacgatgagatgatctgcaagatggcttccaaggct
gatgtattagatgttgtagtggcttcaactgttcagaaagacatggccattatgattgag
gatgagaaagctttaagagaaactgtccgtaaattgggagtgattgattcggaaagaatg
gattttgagctgttgccagatgatgaacgtcagtgtgtaaaatgcaaaactacatgcttc
atgtctgccatctcctgttcttgtaaacctggccttcttgtttgcctgcatcatgtaaaa
gaattgtgttcctgtcctccttacaaatataaattgcggtataggtacacgctggatgat
ctctaccctatgatgaatgcattgaagcttcgagcagaatcttacaacgaatgggccttg
aatgtgaatgaagctttggaggcaaagatcaacaagaagaaaagccttgtcagcttcaag
gctttaattgaagaatctgaaatgaagaaattcccagacaatgatcttttgcgacacctt
cgcctagtcacacaggatgcagagaagtgtgcctctgttgcgcagcagttgcttaatggc
aaaaggcaaactagatatcgatctggtggagggaaatcccaaaatcagttgacagtgaat
gagctccggcagtttgtaacacagctgtatgctcttccatgtgtcctcagtcagacacca
ttactaaaggatctcttgaatcgtgtagaagattttcaacagcatagtcagaaactactc
tctgaggaaacgcctagtgctgcggagctgcaggacttgctagatgtcagctttgaattt
gatgttgaacttccacagcttgctgagatgcgtatccgtttggaacaagcccgttggcta
gaagaggtgcagcaagcttgcctagaccccagctcccttactttagatgatatgagacgt
ctcatagacctaggggtagggctggccccgtattcagcagtggagaaagctatggcccgg
ctgcaggaactgctcacagtgtcagagcactgggacgacaaagccaagagtctcctcaag
gccaggccacgacattcattgaatagccttgctacggcagtaaaggaaatcgaagagatc
cctgcatatctgcccaatggtgcggctctgaaagactcagtgcagagagccagagactgg
cttcaggatgtagagggcctgcaggctggaggacgtgtgccagtgttagacacactcata
gaacttgttacacgaggccgatctatccccgtacatctgaattctttgccaagactggaa
accctagtagctgaggttcaggcttggaaagaatgtgctgttaatacattcttgactgag
aattctccatattctctcttagaggtgctgtgtcctcgatgtgatattggccttttggga
ttgaaaaggaagcagagaaagttaaaggagcccttgccaaatggaaagaaaaaaagcacc
aaattagagagtctgagtgacctggagagagctttaactgaaagcaaggagactgcttca
gctatggcaactcttggggaagctcgcctaagggaaatggaagccttgcagtctctcaga
ctcgccaatgaagggaaattgctgtcgcctctccaagatgtggatataaaaatctgccta
tgtcagaaggccccagctgcccctatgattcaatgtgaactctgcagggatgctttccac
accagttgtgtggcggtacccagtatttcacagggcctgcgaatctggctttgtccccat
tgtcggaggtcagagaaacctccattagagaaaattctgcccctgctcgcctcccttcag
cgtatccgagttcgccttcctgagggagatgcacttcgatatatgattgaaagaaccgtg
aactggcagcacagagcccagcaactgctttcgtcagggaatcttaaatttgtgcaagat
cgagtgggctcaggactgttatatagcagatggcaagcctcagcaggacaggtgtcagac
acaaacaaggtatctcaacctcctggcacaacatcattttctttgcctgatgactgggac
aacagaacctcatatttgcactcccccttctcaactggacgaagttgtatccccctccat
ggtgttagtccagaagtgaatgaactattgatggaagcccagctgctccaggtatccctt
cctgaaattcaggaactttaccagactttacttgcaaagccaagccctgctcagcagact
gaccgaagctcaccagtgagacccagcagtgagaagaatgactgttgccgagggaagcga
gatggaattaacagtcttgagagaaaactgaagagacgcctggaaagagagggcctctcc
agtgagcggtgggaacgagttaagaaaatgcggacccccaaaaagaagaaaatcaaactg
agccaccccaaggacatgaacaatttcaagttagagagagagcgtagctatgaattagtt
cgttctgctgaaactcattccctgccctcagacacatcctattccgaacaggaagactct
gaggatgaagatgccatctgcccagctgtgagctgcctgcagccagaaggagatgaggtg
gactgggtccagtgtgatggcagctgcaatcagtggtttcatcaggtctgtgttggtgtc
tccccagagatggcagagaaagaagactacatctgtgtgcgctgtactgtgaaggacgca
ccaagccgaaagtaa

DBGET integrated database retrieval system