KEGG   Homo sapiens (human): 10769Help
Entry
10769             CDS       T01001                                 

Gene name
PLK2, SNK, hPlk2, hSNK
Definition
(RefSeq) polo like kinase 2
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    10769 (PLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    10769 (PLK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10769 (PLK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     10769 (PLK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   10769 (PLK2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    10769 (PLK2)
   Centrosome duplication proteins
    Regulators of centriole replication
     10769 (PLK2)
  Sister chromatid separation proteins
   Polo kinases
    10769 (PLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Pkinase_fungal Kinase-like G_path_suppress
Motif
Other DBs
NCBI-GeneID: 10769
NCBI-ProteinID: NP_006613
OMIM: 607023
HGNC: 19699
Ensembl: ENSG00000145632
Vega: OTTHUMG00000097047
Pharos: Q9NYY3(Tchem)
UniProt: Q9NYY3 A0A024QZV1
Structure
PDB: 

Position
5q11.2
AA seq 685 aa AA seqDB search
MELLRTITYQPAASTKMCEQALGKGCGADSKKKRPPQPPEESQPPQSQAQVPPAAPHHHH
HHSHSGPEISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAK
PHQREKIDKEIELHRILHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEP
EVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTI
CGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMP
SSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPA
KNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEEL
QPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLR
GCLENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPD
KKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRL
YLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTL
LMSGCSSELKNRMEYALNMLLQRCN
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggagcttttgcggactatcacctaccagccagccgccagcaccaaaatgtgcgagcag
gcgctgggcaagggttgcggagcggactcgaagaagaagcggccgccgcagccccccgag
gaatcgcagccacctcagtcccaggcgcaagtgcccccggcggcccctcaccaccatcac
caccattcgcactcggggccggagatctcgcggattatcgtcgaccccacgactgggaag
cgctactgccggggcaaagtgctgggaaagggtggctttgcaaaatgttacgagatgaca
gatttgacaaataacaaagtctacgccgcaaaaattattcctcacagcagagtagctaaa
cctcatcaaagggaaaagattgacaaagaaatagagcttcacagaattcttcatcataag
catgtagtgcagttttaccactacttcgaggacaaagaaaacatttacattctcttggaa
tactgcagtagaaggtcaatggctcatattttgaaagcaagaaaggtgttgacagagcca
gaagttcgatactacctcaggcagattgtgtctggactgaaataccttcatgaacaagaa
atcttgcacagagatctcaaactagggaacttttttattaatgaagccatggaactaaaa
gttggggacttcggtctggcagccaggctagaacccttggaacacagaaggagaacgata
tgtggtaccccaaattatctctctcctgaagtcctcaacaaacaaggacatggctgtgaa
tcagacatttgggccctgggctgtgtaatgtatacaatgttactagggaggcccccattt
gaaactacaaatctcaaagaaacttataggtgcataagggaagcaaggtatacaatgccg
tcctcattgctggctcctgccaagcacttaattgctagtatgttgtccaaaaacccagag
gatcgtcccagtttggatgacatcattcgacatgacttttttttgcagggcttcactccg
gacagactgtcttctagctgttgtcatacagttccagatttccacttatcaagcccagct
aagaatttctttaagaaagcagctgctgctctttttggtggcaaaaaagacaaagcaaga
tatattgacacacataatagagtgtctaaagaagatgaagacatctacaagcttaggcat
gatttgaaaaagacttcaataactcagcaacccagcaaacacaggacagatgaggagctc
cagccacctaccaccacagttgccaggtctggaacacccgcagtagaaaacaagcagcag
attggggatgctattcggatgatagtcagagggactcttggcagctgtagcagcagcagt
gaatgccttgaagacagtaccatgggaagtgttgcagacacagtggcaagggttcttcgg
ggatgtctggaaaacatgccggaagctgattgcattcccaaagagcagctgagcacatca
tttcagtgggtcaccaaatgggttgattactctaacaaatatggctttgggtaccagctc
tcagaccacaccgtcggtgtccttttcaacaatggtgctcacatgagcctccttccagac
aaaaaaacagttcactattacgcagagcttggccaatgctcagttttcccagcaacagat
gctcctgagcaatttattagtcaagtgacggtgctgaaatacttttctcattacatggag
gagaacctcatggatggtggagatctgcctagtgttactgatattcgaagacctcggctc
tacctccttcagtggctaaaatctgataaggccctaatgatgctctttaatgatggcacc
tttcaggtgaatttctaccatgatcatacaaaaatcatcatctgtagccaaaatgaagaa
taccttctcacctacatcaatgaggataggatatctacaactttcaggctgacaactctg
ctgatgtctggctgttcatcagaattaaaaaatcgaatggaatatgccctgaacatgctc
ttacaaagatgtaactga

DBGET integrated database retrieval system