KEGG   Homo sapiens (human): 10772
Entry
10772             CDS       T01001                                 

Gene name
SRSF10, FUSIP1, FUSIP2, NSSR, PPP1R149, SFRS13, SFRS13A, SRp38, SRrp40, TASR, TASR1, TASR2
Definition
(RefSeq) serine and arginine rich splicing factor 10
  KO
K12900  FUS-interacting serine-arginine-rich protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10772 (SRSF10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    10772 (SRSF10)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10772 (SRSF10)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10772 (SRSF10)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    10772 (SRSF10)
SSDB
Motif
Pfam: RRM_1 Nup35_RRM_2
Other DBs
NCBI-GeneID: 10772
NCBI-ProteinID: NP_473357
OMIM: 605221
HGNC: 16713
Ensembl: ENSG00000188529
Vega: OTTHUMG00000013893
Pharos: O75494(Tbio)
UniProt: O75494 A0A0S2Z504
Position
1p36.11
AA seq 262 aa
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFED
VRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSR
SRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSR
SRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSR
SQSRSRSKSRSRSWTSPKSSGH
NT seq 789 nt   +upstreamnt  +downstreamnt
atgtcccgctacctgcgtccccccaacacgtctctgttcgtcaggaacgtggccgacgac
accaggtctgaagacttgcggcgtgaatttggtcgttatggtcctatagttgatgtgtat
gttccacttgatttctacactcgccgtccaagaggatttgcttatgttcaatttgaggat
gttcgtgatgctgaagacgctttacataatttggacagaaagtggatttgtggacggcag
attgaaatacagtttgcccagggggatcgaaagacaccaaatcagatgaaagccaaggaa
gggaggaatgtgtacagttcttcacgctatgatgattatgacagatacagacgttctaga
agccgaagttatgaaaggaggagatcaagaagtcggtcttttgattacaactatagaaga
tcgtatagtcctagaaacagtagaccgactggaagaccacggcgtagcagaagccattcc
gacaatgatagattcaaacaccgaaatcgatctttttcaagatctaaatccaattcaaga
tcacggtccaagtcccagcccaagaaagaaatgaaggctaaatcacgttctaggtctgca
tctcacaccaaaactagaggcacctctaaaacagattccaaaacacattataagtctggc
tcaagatatgaaaaggaatcaaggaaaaaagaaccacctagatccaaatctcagtcaaga
tcacagtctaggtctaggtcaaaatctagatcaaggtcttggactagtcctaagtccagt
ggccactga

DBGET integrated database retrieval system