KEGG   Homo sapiens (human): 10772Help
Entry
10772             CDS       T01001                                 

Gene name
SRSF10, FUSIP1, FUSIP2, NSSR, PPP1R149, SFRS13, SFRS13A, SRp38, SRrp40, TASR, TASR1, TASR2
Definition
(RefSeq) serine and arginine rich splicing factor 10
  KO
K12900  FUS-interacting serine-arginine-rich protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10772 (SRSF10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    10772 (SRSF10)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10772 (SRSF10)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10772 (SRSF10)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    10772 (SRSF10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 10772
NCBI-ProteinID: NP_473357
OMIM: 605221
HGNC: 16713
Ensembl: ENSG00000188529
Vega: OTTHUMG00000013893
Pharos: O75494(Tbio)
UniProt: O75494 A0A0S2Z504
Position
1p36.11
AA seq 262 aa AA seqDB search
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFED
VRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSR
SRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSR
SRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSR
SQSRSRSKSRSRSWTSPKSSGH
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctacctgcgtccccccaacacgtctctgttcgtcaggaacgtggccgacgac
accaggtctgaagacttgcggcgtgaatttggtcgttatggtcctatagttgatgtgtat
gttccacttgatttctacactcgccgtccaagaggatttgcttatgttcaatttgaggat
gttcgtgatgctgaagacgctttacataatttggacagaaagtggatttgtggacggcag
attgaaatacagtttgcccagggggatcgaaagacaccaaatcagatgaaagccaaggaa
gggaggaatgtgtacagttcttcacgctatgatgattatgacagatacagacgttctaga
agccgaagttatgaaaggaggagatcaagaagtcggtcttttgattacaactatagaaga
tcgtatagtcctagaaacagtagaccgactggaagaccacggcgtagcagaagccattcc
gacaatgatagattcaaacaccgaaatcgatctttttcaagatctaaatccaattcaaga
tcacggtccaagtcccagcccaagaaagaaatgaaggctaaatcacgttctaggtctgca
tctcacaccaaaactagaggcacctctaaaacagattccaaaacacattataagtctggc
tcaagatatgaaaaggaatcaaggaaaaaagaaccacctagatccaaatctcagtcaaga
tcacagtctaggtctaggtcaaaatctagatcaaggtcttggactagtcctaagtccagt
ggccactga

KEGG   Homo sapiens (human): 10929Help
Entry
10929             CDS       T01001                                 

Gene name
SRSF8, DSM-1, SFRS2B, SRP46
Definition
(RefSeq) serine and arginine rich splicing factor 8
  KO
K12891  splicing factor, arginine/serine-rich 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10929 (SRSF8)
 09160 Human Diseases
  09167 Infectious diseases
   05168 Herpes simplex infection
    10929 (SRSF8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10929 (SRSF8)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    10929 (SRSF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_occluded Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 10929
NCBI-ProteinID: NP_115285
OMIM: 603269
HGNC: 16988
Ensembl: ENSG00000263465
Vega: OTTHUMG00000188534
Pharos: Q9BRL6(Tdark)
UniProt: Q9BRL6 A0A024R3A8
Structure
PDB: 

Position
11q21
AA seq 282 aa AA seqDB search
MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFV
RFHDRRDAQDAEAAMDGAELDGRELRVQVARYGRRDLPRSRQGEPRGRSRGGGYGRRSRS
YGRRSRSPRRRHRSRSRGPSCSRSRSRSRYRGSRYSRSPYSRSPYSRSRYSRSPYSRSRY
RESRYGGSHYSSSGYSNSRYSRYHSSRSHSKSGSSTSSRSASTSKSSSARRSKSSSVSRS
RSRSRSSSMTRSPPRVSKRKSKSRSRSKRPPKSPEEEGQMSS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcggccgcccccctcccgacgtggacggcatgatcaccctcaaggtggacaac
ctgacctaccgcacctctcccgacagcttgaggcgcgtgttcgagaagtacgggcgcgtg
ggcgacgtgtacatcccgcgggagccccacaccaaggcgccccggggcttcgctttcgtc
cgctttcacgaccggcgcgacgcccaagacgccgaggccgccatggacggggcggagctg
gacggacgcgagctgcgggtgcaggtggcgcgctatggccgccgggacctgccccgcagc
cgccagggagagccacgcggcaggtccagaggcggcggctacggacggcggagccgcagc
tacgggcggcggagccgcagccccaggcggcgacaccgcagccgatcccggggtcccagc
tgctccaggtcccgcagccgatctcgctataggggttctcgctatagccggtctccctac
agccgatctccttacagccggtcgcgctacagccgctctccctacagcagatctcgctac
agggaatctcgctacggcggatctcactacagctcatctggttacagtaactctcgctac
agccgatatcacagcagccggtctcactcgaagtctgggtcctccactagctctcgctct
gcatcaacctccaaatcgagctctgcgcgacgatccaagtcctcctcggtctccaggtct
cgctcgcggtccaggtcttcatctatgaccaggagtcctccccgggtatccaagaggaaa
tccaagtcaaggtcgcgatccaagaggccccccaagtctcctgaagaggaaggacagatg
tcctcttaa

KEGG   Homo sapiens (human): 29896Help
Entry
29896             CDS       T01001                                 

Gene name
TRA2A, AWMS1, HSU53209
Definition
(RefSeq) transformer 2 alpha homolog
  KO
K12897  transformer-2 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    29896 (TRA2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    29896 (TRA2A)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    29896 (TRA2A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     29896 (TRA2A)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    29896 (TRA2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Apt1 Macoilin
Motif
Other DBs
NCBI-GeneID: 29896
NCBI-ProteinID: NP_037425
OMIM: 602718
HGNC: 16645
Ensembl: ENSG00000164548
Vega: OTTHUMG00000128459
Pharos: Q13595(Tbio)
UniProt: Q13595 Q549U1
Position
7p15.3
AA seq 282 aa AA seqDB search
MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRS
RRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTC
LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERA
NGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYYDR
GYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPRRY
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgtggaggaaaacaacttcgagggcagagagtctcgctctcagtcaaaatct
ccaacgggaactcctgctcgtgtaaaatcggagagcaggtcaggatctcgtagtccatca
agggtttccaaacactctgaatcccattctcgatcaagatcaaaatccaggtcgaggtca
aggagacattctcatagacgttacactcgatccagatcccactctcactctcataggaga
cgatctcgaagtagatcatatacaccagaataccggcggcgaaggagccgaagccattct
ccaatgtctaaccggagaagacatactggcagcagggcaaatccagatcccaacacttgc
cttggagtgtttggcctcagtttgtacacaacagagagggatcttcgtgaagtattttct
cgatatggaccattgagtggtgtcaatgtggtttatgatcagcgaactgggcgatctcga
ggatttgcttttgtgtattttgagagaatagatgactcaaaggaggctatggaaagggca
aatggaatggagctggatggtagaagaattcgggtggattattctataaccaagagagcg
cacacaccaacaccaggcatctacatgggcagaccaactcatagtggtgggggtggtgga
ggaggcggcggcggtggaggtggaggtggtggcagacgtcgagattcttactatgataga
ggatatgatcgtgggtatgacagatatgaagactatgattaccgatacagaagacgatca
ccttctccttattatagtcgatatagatcacgatcaagatctcgttcctacagcccaaga
cgctattga

KEGG   Homo sapiens (human): 6426Help
Entry
6426              CDS       T01001                                 

Gene name
SRSF1, ASF, SF2, SF2p33, SFRS1, SRp30a
Definition
(RefSeq) serine and arginine rich splicing factor 1
  KO
K12890  splicing factor, arginine/serine-rich 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04657  IL-17 signaling pathway
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6426 (SRSF1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6426 (SRSF1)
 09160 Human Diseases
  09167 Infectious diseases
   05168 Herpes simplex infection
    6426 (SRSF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6426 (SRSF1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6426 (SRSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Nup35_RRM_2 RRM_occluded RRM_3 RRM_7 Corona_nucleoca DDE_Tnp_1
Motif
Other DBs
NCBI-GeneID: 6426
NCBI-ProteinID: NP_008855
OMIM: 600812
HGNC: 10780
Ensembl: ENSG00000136450
Vega: OTTHUMG00000178781
Pharos: Q07955(Tbio)
UniProt: Q07955
Structure
PDB: 

Position
17q22
AA seq 248 aa AA seqDB search
MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVE
FEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSE
NRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKF
RSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPR
HSRSRSRT
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaggtggtgtgattcgtggccccgcagggaacaacgattgccgcatctacgtg
ggtaacttacctccagacatccgaaccaaggacattgaggacgtgttctacaaatacggc
gctatccgcgacatcgacctcaagaatcgccgcgggggaccgcccttcgccttcgttgag
ttcgaggacccgcgagacgcggaagacgcggtgtatggtcgcgacggctatgattacgat
gggtaccgtctgcgggtggagtttcctcgaagcggccgtggaacaggccgaggcggcggc
gggggtggaggtggcggagctccccgaggtcgctatggccccccatccaggcggtctgaa
aacagagtggttgtctctggactgcctccaagtggaagttggcaggatttaaaggatcac
atgcgtgaagcaggtgatgtatgttatgctgatgtttaccgagatggcactggtgtcgtg
gagtttgtacggaaagaagatatgacctatgcagttcgaaaactggataacactaagttt
agatctcatgagggagaaactgcctacatccgggttaaagttgatgggcccagaagtcca
agttatggaagatctcgatctcgaagccgtagtcgtagcagaagccgtagcagaagcaac
agcaggagtcgcagttactccccaaggagaagcagaggatcaccacgctattctccccgt
catagcagatctcgctctcgtacataa

KEGG   Homo sapiens (human): 6427Help
Entry
6427              CDS       T01001                                 

Gene name
SRSF2, PR264, SC-35, SC35, SFRS2, SFRS2A, SRp30b
Definition
(RefSeq) serine and arginine rich splicing factor 2
  KO
K12891  splicing factor, arginine/serine-rich 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex infection
Disease
H01481  Myelodysplastic syndrome (MDS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6427 (SRSF2)
 09160 Human Diseases
  09167 Infectious diseases
   05168 Herpes simplex infection
    6427 (SRSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6427 (SRSF2)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6427 (SRSF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Nup35_RRM_2 RRM_5 RRM_occluded RRM_3
Motif
Other DBs
NCBI-GeneID: 6427
NCBI-ProteinID: NP_001182356
OMIM: 600813
HGNC: 10783
Ensembl: ENSG00000161547
Vega: OTTHUMG00000177547
Pharos: Q01130(Tbio)
UniProt: Q01130 A0A024R8U5 Q53FN0
Structure
PDB: 

Position
17q25.1
AA seq 221 aa AA seqDB search
MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFV
RFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSR
SPRRRRRSRSRSRSRSRSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSR
SRSRSRSRSRSPPPVSKRESKSRSRSKSPPKSPEEEGAVSS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagctacggccgcccccctcccgatgtggagggtatgacctccctcaaggtggacaac
ctgacctaccgcacctcgcccgacacgctgaggcgcgtcttcgagaagtacgggcgcgtc
ggcgacgtgtacatcccgcgggaccgctacaccaaggagtcccgcggcttcgccttcgtt
cgctttcacgacaagcgcgacgctgaggacgctatggatgccatggacggggccgtgctg
gacggccgcgagctgcgggtgcaaatggcgcgctacggccgccccccggactcacaccac
agccgccggggaccgccaccccgcaggtacgggggcggtggctacggacgccggagccgc
agccctaggcggcgtcgccgcagccgatcccggagtcggagccgttccaggtctcgcagc
cgatctcgctacagccgctcgaagtctcggtcccgcactcgttctcgatctcggtcgacc
tccaagtccagatccgcacgaaggtccaagtccaagtcctcgtcggtctccagatctcgt
tcgcggtccaggtcccggtctcggtccaggagtcctcccccagtgtccaagagggaatcc
aaatccaggtcgcgatcgaagagtccccccaagtctcctgaagaggaaggagcggtgtcc
tcttaa

KEGG   Homo sapiens (human): 6428Help
Entry
6428              CDS       T01001                                 

Gene name
SRSF3, SFRS3, SRp20
Definition
(RefSeq) serine and arginine rich splicing factor 3
  KO
K12892  splicing factor, arginine/serine-rich 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6428 (SRSF3)
 09160 Human Diseases
  09167 Infectious diseases
   05168 Herpes simplex infection
    6428 (SRSF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6428 (SRSF3)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6428 (SRSF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 RRM_occluded
Motif
Other DBs
NCBI-GeneID: 6428
NCBI-ProteinID: NP_003008
OMIM: 603364
HGNC: 10785
Ensembl: ENSG00000112081
Vega: OTTHUMG00000014599
Pharos: P84103(Tbio)
UniProt: P84103 B2R6F3
Structure
PDB: 

Position
6p21.31-p21.2
AA seq 164 aa AA seqDB search
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAA
DAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRS
FSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtgattcctgtccattggactgtaaggtttatgtaggcaatcttggaaacaat
ggcaacaagacggaattggaacgggcttttggctactatggaccactccgaagtgtgtgg
gttgctagaaacccacccggctttgcttttgttgaatttgaagatccccgagatgcagct
gatgcagtccgagagctagatggaagaacactatgtggctgccgtgtaagagtggaactg
tcgaatggtgaaaaaagaagtagaaatcgtggcccacctccctcttggggtcgtcgccct
cgagatgattatcgtaggaggagtcctccacctcgtcgcagatctccaagaaggagaagc
ttctctcgcagccggagcaggtccctttctagagataggagaagagagagatcgctgtct
cgggagagaaatcacaagccgtcccgatccttctctaggtctcgtagtcgatctaggtca
aatgaaaggaaatag

KEGG   Homo sapiens (human): 6429Help
Entry
6429              CDS       T01001                                 

Gene name
SRSF4, SFRS4, SRP75
Definition
(RefSeq) serine and arginine rich splicing factor 4
  KO
K12893  splicing factor, arginine/serine-rich 4/5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6429 (SRSF4)
 09160 Human Diseases
  09167 Infectious diseases
   05168 Herpes simplex infection
    6429 (SRSF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6429 (SRSF4)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6429 (SRSF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_3 Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 6429
NCBI-ProteinID: NP_005617
OMIM: 601940
HGNC: 10786
Ensembl: ENSG00000116350
Vega: OTTHUMG00000003663
Pharos: Q08170(Tbio)
UniProt: Q08170
Position
1p35.3
AA seq 494 aa AA seqDB search
MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDL
CGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDL
KDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVEDKPGSR
RRRSYSRSRSHSRSRSRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSRSRSKSRSRSQSRS
RSKKEKSRSPSKEKSRSRSHSAGKSRSKSKDQAEEKIQNNDNVGKPKSRSPSRHKSKSKS
RSRSQERRVEEEKRGSVSRGRSQEKSLRQSRSRSRSKGGSRSRSRSRSKSKDKRKGRKRS
REESRSRSRSRSKSERSRKRGSKRDSKAGSSKKKKKEDTDRSQSRSPSRSVSKEREHAKS
ESSQREGRGESENAGTNQETRSRSRSNSKSKPNLPSESRSRSKSASKTRSRSKSRSRSAS
RSPSRSRSRSHSRS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgggtgtacatcggccgcctgagctaccaggcccgggagcgcgatgtggagcgc
ttctttaagggctacgggaagatcctggaggtggatctgaagaacggatatggttttgtg
gagtttgatgatctgcgtgatgcagatgatgctgtttatgaactgaatggcaaagacctt
tgtggtgagcgagtaattgttgagcatgcccgcggcccacggcgagatggcagttacggt
tctggacgcagtggatatggttatagaagaagtggccgagataaatatggccctcctact
cgcacagagtacagacttattgtggagaatttgtcaagtcggtgcagctggcaagaccta
aaggattatatgcgtcaggcaggagaagtgacttatgcagatgctcacaagggacgcaaa
aatgaaggggtgattgaatttgtatcttattctgatatgaaaagagctttggaaaagttg
gatggaactgaagtcaatgggagaaaaatcagattagttgaagacaagccaggttccaga
cgacgccggtcctactccagaagccggagtcattcaaggtctcgctctcgaagcagacat
tcccgtaagagcagaagccgaagtggcagcagcaaaagcagtcattctaagagtagatct
cggtccaggtcgggctcccgctcccggagcaagagccggagccggagccagagtcggagc
cggagcaagaaagagaaaagcaggagccccagcaaggaaaagagccgcagccgcagccat
agcgctggcaagagccgcagcaagagcaaagaccaagctgaagagaagatccaaaacaat
gacaatgtcgggaaacccaagagccggagtcctagcaggcataaaagtaagagcaaaagt
cggagcaggagtcaggagaggagagtggaggaggagaagcgagggagtgtgagcaggggc
aggagccaggagaagagcctccgccagagtcggagccggagcaggagcaaagggggcagc
aggagccggagcaggagccgcagcaagagcaaggacaagaggaagggcaggaagagaagc
agagaggagagccgcagtcgcagtcgcagccgcagcaagagtgagaggagcagaaagcga
ggcagcaagcgagacagcaaggcgggcagcagcaagaagaagaagaaggaagacactgac
cgctcccagtccagatctccatcccgctccgtgtcaaaggagcgggaacatgccaagtct
gaatccagccagagggaaggtcgaggagagagtgagaatgctggcaccaatcaggagacc
cggtccaggtcgagatccaattccaaatcgaaaccaaaccttccatcagaatcacgctcc
agatcaaagtcagcttcaaaaacccgatctcggtccaagtctagatccaggtctgcttcc
agatcgccctcccgatctagatctaggtcccactcaaggtcctaa

KEGG   Homo sapiens (human): 6430Help
Entry
6430              CDS       T01001                                 

Gene name
SRSF5, HRS, SFRS5, SRP40
Definition
(RefSeq) serine and arginine rich splicing factor 5
  KO
K12893  splicing factor, arginine/serine-rich 4/5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6430 (SRSF5)
 09160 Human Diseases
  09167 Infectious diseases
   05168 Herpes simplex infection
    6430 (SRSF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6430 (SRSF5)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6430 (SRSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_3 Nup35_RRM_2 RRM_5
Motif
Other DBs
NCBI-GeneID: 6430
NCBI-ProteinID: NP_001034554
OMIM: 600914
HGNC: 10787
Ensembl: ENSG00000100650
Vega: OTTHUMG00000171235
Pharos: Q13243(Tbio)
UniProt: Q13243 A0A024R6D8
Position
14q24.1
AA seq 272 aa AA seqDB search
MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGK
ELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVS
WQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIEGS
KRHSRSRSRSRSRTRSSSRSRSRSRSRSRKSYSRSRSRSRSRSRSKSRSVSRSPVPEKSQ
KRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtggctgtcgggtattcatcgggagactaaatccagcggccagggagaaggacgtg
gaaagattcttcaagggatatggacggataagagatattgatctgaaaagaggctttggt
tttgtggaatttgaggatccaagggatgcagatgatgctgtgtatgagcttgatggaaaa
gaactctgtagtgaaagggttactattgaacatgctagggctcggtcacgaggtggaaga
ggtagaggacgatactctgaccgttttagtagtcgcagacctcgaaatgatagacgaaat
gctccacctgtaagaacagaaaatcgtcttatagttgagaatttatcctcaagagtcagc
tggcaggatctcaaagatttcatgagacaagctggggaagtaacgtttgcggatgcacac
cgacctaaattaaatgaaggggtggttgagtttgcctcttatggtgacttaaagaatgct
attgaaaaactttctggaaaggaaataaatgggagaaaaataaaattaattgaaggcagc
aaaaggcacagtaggtcaagaagcaggtctcgatcccggaccagaagttcctctaggtct
cgtagccgatcccgttcccgtagtcgcaaatcttacagccggtcaagaagcaggagcagg
agccggagccggagcaagtcccgttctgttagtaggtctcccgtgcctgagaagagccag
aaacgtggttcttcaagtagatctaagtctccagcatctgtggatcgccagaggtcccgg
tcccgatcaaggtccagatcagttgacagtggcaattaa

KEGG   Homo sapiens (human): 6431Help
Entry
6431              CDS       T01001                                 

Gene name
SRSF6, B52, HEL-S-91, SFRS6, SRP55
Definition
(RefSeq) serine and arginine rich splicing factor 6
  KO
K12893  splicing factor, arginine/serine-rich 4/5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6431 (SRSF6)
 09160 Human Diseases
  09167 Infectious diseases
   05168 Herpes simplex infection
    6431 (SRSF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6431 (SRSF6)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6431 (SRSF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_3 RRM_occluded RRM_5 Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 6431
NCBI-ProteinID: NP_006266
OMIM: 601944
HGNC: 10788
Ensembl: ENSG00000124193
Vega: OTTHUMG00000032502
Pharos: Q13247(Tbio)
UniProt: Q13247
Position
20q13.11
AA seq 344 aa AA seqDB search
MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKEL
CGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSR
CSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIE
DKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKG
RKSRSKSKSKPKSDRGSHSHSRSRSKDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSR
SNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRSRSSSRD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcgtctacataggacgcctgagctacaacgtccgggagaaggacatccagcgc
tttttcagtggctatggccgcctcctcgaagtagacctcaaaaatgggtacggcttcgtg
gagttcgaggactcccgcgacgccgacgacgccgtttacgagctgaacggcaaggagctc
tgcggcgagcgcgtgatcgtagagcacgcccggggcccgcgtcgcgatcgcgacggctac
agctacggaagccgcagtggtggaggtggatacagcagtcggagaacatctggcagagac
aaatacggaccacctgttcgtacagaatacaggcttattgtagaaaatctttctagtcgg
tgcagttggcaagatttaaaggattttatgcgacaagcaggtgaagtaacctatgcggat
gcccacaaggaacgaacaaatgagggtgtaattgagtttcgctcctactctgacatgaag
cgtgctttggacaaactggatggcacagaaataaatggcagaaatattaggcttattgaa
gataagccacgcacaagccataggcgatcttactctggaagcagatccaggtctcgatct
agaagacggtcacgaagtaggagtcgcaggagcagccgcagtagatctcgaagtatctca
aaaagtcgctcccgttccaggtcgcggagcaaaggtcgatcacgttctcgatcaaaaggc
aggaaatctagatcaaagagcaaatctaagcccaagtctgatcggggctcccattcacat
tctcgaagcagatctaaggatgagtatgagaaatctcgaagcaggtctcggtcccgatcc
cctaaagaaaatggaaagggtgatataaagtcaaaatccagatcaaggagccagtcccgt
tccaattcgccgctacctgttccaccctcaaaggcccgttctgtgtcccctccaccaaaa
agagctacttcaagatcccgttctagatctcgctcaaagtcaagatcaaggtccaggtcg
agttccagagattaa

KEGG   Homo sapiens (human): 6432Help
Entry
6432              CDS       T01001                                 

Gene name
SRSF7, 9G8, AAG3, SFRS7
Definition
(RefSeq) serine and arginine rich splicing factor 7
  KO
K12896  splicing factor, arginine/serine-rich 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6432 (SRSF7)
 09160 Human Diseases
  09167 Infectious diseases
   05168 Herpes simplex infection
    6432 (SRSF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6432 (SRSF7)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6432 (SRSF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 zf-CCHC RRM_5 zf-CCHC_3
Motif
Other DBs
NCBI-GeneID: 6432
NCBI-ProteinID: NP_001026854
OMIM: 600572
HGNC: 10789
Ensembl: ENSG00000115875
Vega: OTTHUMG00000102076
Pharos: Q16629(Tbio)
UniProt: Q16629
Structure
PDB: 

Position
2p22.1
AA seq 238 aa AA seqDB search
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
EDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH
RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSR
SGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgttacgggcggtacggaggagaaaccaaggtgtatgttggtaacctgggaact
ggcgctggcaaaggagagttagaaagggctttcagttattatggtcctttaagaactgta
tggattgcgagaaatcctccaggatttgcctttgtggaattcgaagatcctagagatgca
gaagatgcagtacgaggactggatggaaaggtgatttgtggctcccgagtgagggttgaa
ctatcgacaggcatgcctcggagatcacgttttgatagaccacctgcccgacgtcccttt
gatccaaatgatagatgctatgagtgtggcgaaaagggacattatgcttatgattgtcat
cgttacagccggcgaagaagaagcaggtcacggtctagatcacattctcgatccagagga
aggcgatactctcgctcacgcagcaggagcaggggacgaaggtcaaggtcagcatctcct
cgacgatcaagatctatctctcttcgtagatcaagatcagcttcactcagaagatctagg
tctggttctataaaaggatcgaggtatttccaatccccgtcgaggtcaagatcaagatcc
aggtctatttcacgaccaagaagcagccgatcaaagtccagatctccatctccaaaaaga
agtcgttccccatcaggaagtcctcgcagaagtgcaagtcctgaaagaatggactga

KEGG   Homo sapiens (human): 6434Help
Entry
6434              CDS       T01001                                 

Gene name
TRA2B, Htra2-beta, PPP1R156, SFRS10, SRFS10, TRA2-BETA, TRAN2B
Definition
(RefSeq) transformer 2 beta homolog
  KO
K12897  transformer-2 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6434 (TRA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    6434 (TRA2B)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6434 (TRA2B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6434 (TRA2B)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6434 (TRA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_3 RRM_occluded Apt1 MIP-T3
Motif
Other DBs
NCBI-GeneID: 6434
NCBI-ProteinID: NP_004584
OMIM: 602719
HGNC: 10781
Ensembl: ENSG00000136527
Vega: OTTHUMG00000156641
Pharos: P62995(Tbio)
UniProt: P62995
Structure
PDB: 

Position
3q27.2
AA seq 288 aa AA seqDB search
MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRS
RRSSRRHYTRSRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCL
GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERAN
GMELDGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGYDDRDYYSRSY
RGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRSRSYSPRRY
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagcggcgagcagaactacggcgagcgggaatcccgttctgcttccagaagt
ggaagtgctcacggatcggggaaatctgcaaggcatacccctgcaaggtctcgctccaag
gaagattccaggcgttccagatcaaagtccaggtcccgatctgaatctaggtctagatcc
agaagaagctcccgaaggcattatacccggtcacggtctcgctcccgctcccatagacga
tcacgtagcaggtcttacagtcgagattatcgtagacggcacagccacagccattctccc
atgtctactcgcaggcgtcatgttgggaatcgggcaaatcctgatcctaactgttgtctt
ggagtatttgggctgagcttgtacaccacagaaagagatctaagagaagtgttctctaaa
tatggtcccattgccgatgtgtctattgtatatgaccagcagtctaggcgttcaagagga
tttgcctttgtatattttgaaaatgtagatgatgccaaggaagctaaagaacgtgccaat
ggaatggagcttgatgggcgtaggatcagagttgatttctctataacaaaaagaccacat
acgccaacaccaggaatttacatggggagacctacctatggcagctctcgccgtcgggat
tactatgacagaggatatgatcggggctatgatgatcgggactactatagcagatcatac
agaggaggaggtggaggaggaggaggatggagagctgcccaagacagggatcagatttat
agaaggcggtcaccttctccttactatagtcgtggaggatacagatcacgttccagatct
cgatcatactcacctcgtcgctattaa

KEGG   Homo sapiens (human): 8683Help
Entry
8683              CDS       T01001                                 

Gene name
SRSF9, SFRS9, SRp30c
Definition
(RefSeq) serine and arginine rich splicing factor 9
  KO
K21123  splicing factor, arginine/serine-rich 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    8683 (SRSF9)
 09160 Human Diseases
  09167 Infectious diseases
   05168 Herpes simplex infection
    8683 (SRSF9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    8683 (SRSF9)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    8683 (SRSF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Nup35_RRM_2 RRM_3 RRM_7 RRM_occluded
Motif
Other DBs
NCBI-GeneID: 8683
NCBI-ProteinID: NP_003760
OMIM: 601943
HGNC: 10791
Ensembl: ENSG00000111786
Vega: OTTHUMG00000047790
Pharos: Q13242(Tbio)
UniProt: Q13242
Position
12q24.31
AA seq 221 aa AA seqDB search
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFE
DPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPP
SGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYI
RVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctgggcggacgagcgcggcggcgagggcgacgggcgcatctacgtggggaac
cttccgaccgacgtgcgcgagaaggacttggaggacctgttctacaagtacggccgcatc
cgcgagatcgagctcaagaaccggcacggcctcgtgcccttcgccttcgtgcgcttcgag
gacccccgagatgcagaggatgctatttatggaagaaatggttatgattatggccagtgt
cggcttcgtgtggagttccccaggacttatggaggtcggggtgggtggccccgtggtggg
aggaatgggcctcctacaagaagatctgatttccgagttcttgtttcaggacttcctccg
tcaggcagctggcaggacctgaaggatcacatgcgagaagctggggatgtctgttatgct
gatgtgcagaaggatggagtggggatggtcgagtatctcagaaaagaagacatggaatat
gccctgcgtaaactggatgacaccaaattccgctctcatgagggtgaaacttcctacatc
cgagtttatcctgagagaagcaccagctatggctactcacggtctcggtctgggtcaagg
ggccgtgactctccataccaaagcaggggttccccacactacttctctcctttcaggccc
tactga

DBGET integrated database retrieval system