KEGG   Homo sapiens (human): 10776
Entry
10776             CDS       T01001                                 

Gene name
ARPP19, ARPP-16, ARPP-19, ARPP16, ENSAL
Definition
(RefSeq) cAMP regulated phosphoprotein 19
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Endosulfine Ntox30
Other DBs
NCBI-GeneID: 10776
NCBI-ProteinID: NP_001293124
OMIM: 605487
HGNC: 16967
Ensembl: ENSG00000128989
Vega: OTTHUMG00000172677
Pharos: P56211(Tbio)
UniProt: P56211 A0A024R5U3
Position
15q21.2
AA seq 112 aa
MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYF
DSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG
NT seq 339 nt   +upstreamnt  +downstreamnt
atgtctgcggaagtccccgaggcagcctccgcggaggagcagaaggaaatggaagataaa
gtgactagtccagagaaagcagaagaagcaaaattaaaagcaagatatcctcatctggga
caaaagcctggaggttcagatttcttaaggaaacggttgcagaaagggcaaaaatatttt
gattctggggattacaacatggctaaagcaaaaatgaagaacaagcaacttcctactgca
gctccggataagacggaggtcactggtgaccacattcccactccgcaagaccttcctcaa
cggaagccgtcccttgttgctagcaagctggctggctga

DBGET integrated database retrieval system