KEGG   Homo sapiens (human): 10777Help
Entry
10777             CDS       T01001                                 

Gene name
ARPP21, ARPP-21, R3HDM3, RCS, TARPP
Definition
(RefSeq) cAMP regulated phosphoprotein 21
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: R3H SUZ
Motif
Other DBs
NCBI-GeneID: 10777
NCBI-ProteinID: NP_057384
OMIM: 605488
HGNC: 16968
Ensembl: ENSG00000172995
Vega: OTTHUMG00000130795
Pharos: Q9UBL0(Tbio)
UniProt: Q9UBL0
Position
3p22.3
AA seq 812 aa AA seqDB search
MSEQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGA
GKGKLTRSLAVCEESSARPGGESLQDQESIHLQLSSFSSLQEEDKSRKDDSEREKEKDKN
KDKTSEKPKIRMLSKDCSQEYTDSTGIDLHEFLINTLKNNSRDRMILLKMEQEIIDFIAD
NNNHYKKFPQMSSYQRMLVHRVAAYFGLDHNVDQTGKSVIINKTSSTRIPEQRFCEHLKD
EKGEESQKRFILKRDNSSIDKEDNQQNRMHPFRDDRRSKSIEEREEEYQRVRERIFAHDS
VCSQESLFVENSRLLEDSNICNETYKKRQLFRGNRDGSGRTSGSRQSSSENELKWSDHQR
AWSSTDSDSSNRNLKPAMTKTASFGGITVLTRGDSTSSTRSTGKLSKAGSESSSSAGSSG
SLSRTHPPLQSTPLVSGVAAGSPGCVPYPENGIGGQVAPSSTSYILLPLEAATGIPPGSI
LLNPHTGQPFVNPDGTPAIYNPPTSQQPLRSAMVGQSQQQPPQQQPSPQPQQQVQPPQPQ
MAGPLVTQRDDVATQFGQMTLSRQSSGETPEPPSGPVYPSSLMPQPAQQPSYVIASTGQQ
LPTGGFSGSGPPISQQVLQPPPSPQGFVQQPPPAQMPVYYYPSGQYPTSTTQQYRPMAPV
QYNAQRSQQMPQAAQQAGYQPVLSGQQGFQGLIGVQQPPQSQNVINNQQGTPVQSVMVSY
PTMSSYQVPMTQGSQGLPQQSYQQPIMLPNQAGQGSLPATGMPVYCNVTPPTPQNNLRLI
GPHCPSSTVPVMSASCRTNCASMSNAGWQVKF
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcaaggagacctgaatcaggcaatagcagaggaaggagggactgagcaggag
acggccactccagagaacggcattgttaaatcagaaagtctggatgaagaggagaaactg
gaactgcagaggcggctggaggctcagaatcaagaaagaagaaaatccaagtcaggagca
ggaaaaggtaaactgactcgcagccttgctgtctgtgaggaatcttctgccagaccagga
ggtgaaagtcttcaggatcaggaatcaattcatttacagctttccagtttttccagcctg
caagaggaggataaatctaggaaagatgactctgaaagagaaaaagaaaaggataaaaac
aaagataaaacctctgaaaaacccaagatcagaatgttatcaaaagattgcagccaagaa
tacacggattctacaggcatagacttacacgagtttctgattaacacattaaagaataat
tccagggacaggatgatacttttgaaaatggagcaggaaattattgatttcattgctgac
aacaataatcattataaaaagttccctcagatgtcatcgtatcagaggatgcttgtccat
cgagtggcagcttattttggattggatcacaatgtggatcaaacaggaaaatctgttatc
atcaacaagaccagcagcaccagaataccagagcaaaggttttgtgaacatttaaaagat
gaaaaaggtgaagaatcccagaagcggtttatcttgaagcgagataactctagtattgat
aaagaagacaatcagcaaaacagaatgcatccatttagagatgacagacgaagtaaatca
attgaagagagagaagaggaatatcagagagtgagggagagaatatttgcacacgattca
gtttgctcccaggaaagcctttttgtggaaaacagtaggctcttggaagacagtaacata
tgcaatgagacctataagaaaagacagctctttcggggcaacagagatggctcagggaga
acatctgggagtcgacagagcagctcagaaaatgaactcaagtggtctgaccaccaaagg
gcctggagcagcacagactccgacagttccaaccgcaatctaaagcccgccatgaccaag
acggcgagttttgggggcatcacggtgctgaccaggggtgacagcacttccagtactagg
agtaccgggaagctgtccaaagcaggttccgagtcttccagcagtgcaggctcctcagga
tcgctgtcccgcacccatccacctctccagagcacacccctagtctcaggtgtggcagct
ggctctccaggctgtgtgccttatccagagaatggaatagggggccaggttgctcccagc
agcaccagctacatcctccttccacttgaagctgcaacaggcatcccgcctggaagcatc
cttcttaatccacacacaggccagccctttgtgaatcccgatggaactcctgcaatatac
aacccacccaccagtcagcagcccctgcgaagcgccatggtggggcagtcccaacagcag
ccaccacagcagcagccctccccgcagccccaacagcaggtccagccaccgcagccacag
atggcaggccctctggtcactcagagagatgatgtggcaacacagtttggccagatgacc
ctgagccggcagtcctcgggggagactcctgaacccccatcaggtcctgtctacccatcc
tcccttatgccacagccggcccagcagcccagctatgtaatcgcctctacaggccagcag
cttcctacaggaggattctcaggctctggccctcccatctcccagcaggtcctccagccc
cctccctcaccacagggatttgtgcaacagcctccgcctgcacagatgcctgtatattat
tacccatctggtcagtaccctacctcaaccacgcaacagtaccggcccatggccccggtt
cagtacaacgctcagaggagtcaacagatgccacaggcagcacagcaagcaggttaccag
ccagtcttgtctggtcaacagggattccaaggcctaataggagtgcagcagccacctcag
agtcagaacgtgataaataaccaacaaggaactccggtgcaaagcgtgatggtttcctac
ccaacaatgtcttcttatcaggtgccaatgacccagggttctcaaggactgccccagcag
tcataccaacagccaatcatgctacctaaccaggcaggtcaagggtcactcccagccact
ggaatgcctgtttactgtaatgtcacaccgcccacccctcagaacaaccttaggctgatt
ggcccacactgcccctccagcactgtcccagtgatgtcagctagctgcagaacaaactgt
gcaagtatgagcaatgctggttggcaggtcaaattctga

DBGET integrated database retrieval system