KEGG   Homo sapiens (human): 10786
Entry
10786             CDS       T01001                                 

Symbol
SLC17A3, GOUT4, NPT4, UAQTL4
Name
(RefSeq) solute carrier family 17 member 3
  KO
K12300  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 1/2/3/4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    10786 (SLC17A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   10786 (SLC17A3)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    10786 (SLC17A3)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 10786
NCBI-ProteinID: NP_006623
OMIM: 611034
HGNC: 10931
Ensembl: ENSG00000124564
Vega: OTTHUMG00000014412
Pharos: O00476(Tbio)
UniProt: O00476 A0A024QZX7
Position
6p22.2
AA seq 420 aa
MATKTELSPTARESKNAQDMQVDETLIPRKVPSLCSARYGIALVLHFCNFTTIAQNVIMN
ITMVAMVNSTSPQSQLNDSSEVLPVDSFGGLSKAPKSLPAKSSILGGQFAIWEKWGPPQE
RSRLCSIALSGMLLGCFTAILIGGFISETLGWPFVFYIFGGVGCVCCLLWFVVIYDDPVS
YPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWSICLGCFSHQWLVSTMVVYIP
TYISSVYHVNIRDNGLLSALPFIVAWVIGMVGGYLADFLLTKKFRLITVRKIATILGSLP
SSALIVSLPYLNSGYITATALLTLSCGLSTLCQSGIYINVLDIAPRYSSFLMGASRGFSS
IAPVIVPTVSGFLLSQDPEFGWRNVFFLLFAVNLLGLLFYLIFGEADVQEWAKERKLTRL
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggccaccaagacagagttgagtcccacagcaagggagagcaagaacgcacaagatatg
caagtggatgagacactgatccccaggaaagttccaagtttatgttctgctcgctatgga
atagccctcgtcttacatttctgcaatttcacaacgatagcacaaaatgtcatcatgaac
atcaccatggtagccatggtcaacagcacaagccctcaatcccagctcaatgattcctct
gaggtgctgcctgttgactcatttggtggcctaagtaaagccccaaagagtcttcctgca
aagtcctcaatacttgggggtcagtttgcaatttgggaaaagtggggccctccacaagaa
cgaagcagactctgcagcattgctttatcaggaatgttactgggatgctttactgccatc
ctcataggtggcttcattagtgaaacccttgggtggccctttgtcttctatatctttgga
ggtgttggctgtgtctgctgccttctctggtttgttgtgatttatgatgaccccgtttcc
tatccatggataagcacctcagaaaaagaatacatcatatcctccttgaaacaacaggtc
gggtcttctaagcagcctcttcccatcaaagctatgctcagatctctacccatttggtcc
atatgtttaggctgtttcagccatcaatggttagttagcacaatggttgtatacatacca
acttacatcagctctgtgtaccatgttaacatcagagacaatggacttctatctgccctt
ccttttattgttgcctgggtcataggcatggtgggaggctatctggcagatttccttcta
accaaaaagtttagactcatcactgtgaggaaaattgccacaattttaggaagtctcccc
tcttcagcactcattgtgtctctgccttacctcaattccggctatatcacagcaactgcc
ttgctgacgctctcttgcggattaagcacattgtgtcagtcagggatttatatcaatgtc
ttagatattgctccaaggtattccagttttctcatgggagcatcaagaggattttcgagc
atagcacctgtcattgtacccactgtcagtggatttcttcttagtcaggaccctgagttt
gggtggaggaatgtcttcttcttgctgtttgccgttaacctgttaggactactcttctac
ctcatatttggagaagcagatgtccaagaatgggctaaagagagaaaactcactcgttta
tga

DBGET integrated database retrieval system