KEGG   Homo sapiens (human): 10787
Entry
10787             CDS       T01001                                 

Gene name
NCKAP1, HEM2, NAP1, NAP125, p125Nap1
Definition
(RefSeq) NCK associated protein 1
  KO
K05750  NCK-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10787 (NCKAP1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10787 (NCKAP1)
   05132 Salmonella infection
    10787 (NCKAP1)
SSDB
Motif
Pfam: Nckap1
Other DBs
NCBI-GeneID: 10787
NCBI-ProteinID: NP_038464
OMIM: 604891
HGNC: 7666
Ensembl: ENSG00000061676
Vega: OTTHUMG00000132623
Pharos: Q9Y2A7(Tbio)
UniProt: Q9Y2A7
Structure
PDB: 
3P8C 4N78

Position
2q32.1
AA seq 1128 aa
MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFI
VRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVF
FDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQ
MIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTML
NPAQSDTMPCEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLSLFRDEV
FHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQ
PGLLGPKALFVFMALSFARDEIIWLLRHADNMPKKSADDFIDKHIAELIFYMEELRAHVR
KYGPVMQRYYVQYLSGFDAVVLNELVQNLSVCPEDESIIMSSFVNTMTSLSVKQVEDGEV
FDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLS
IFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCN
MFLDEMAKQARNLITDICTEQCTLSDQLLPKHCAKTISQAVNKKSKKQTGKKGEPEREKP
GVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRFTKSI
VGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHG
EPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENELTFNAEEYSDISEMRSLS
ELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSV
DSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYE
LSSAAGLPCEIDPALVVALSSQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSP
AIEGHCNNIHCLAKAINQIAAALFTIHKGSIEDRLKEFLALASSSLLKIGQETDKTTTRN
RESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQSVTSSA
NT seq 3387 nt   +upstreamnt  +downstreamnt
atgtcgcgctcagtgctgcagcccagtcagcagaagctggcggagaagctcaccatcctc
aacgaccggggcgtcggcatgctcacccgcctctacaacatcaagaaggcatgtggagac
cccaaggcaaaaccatcctatcttatcgacaaaaacctggaatctgctgtgaaattcata
gtcagaaaattccctgctgtagaaacccgcaacaacaatcaacagcttgcacaactacag
aaagaaaaatcagagattctgaaaaatctggcattatattacttcacatttgtagatgtt
atggaatttaaggaccatgtttgtgaattgctgaatactattgacgtttgccaagtcttc
tttgatattactgtaaactttgatttaacaaagaactacttagatttaattataacctat
acaacactaatgatactgctgtctcgaattgaagaaaggaaggcaatcattggattatac
aactatgcccatgaaatgactcatggagcaagtgacagagaatacccacgccttggccag
atgattgtggattatgaaaaccctttaaagaagatgatggaagaatttgtaccccatagc
aagtctctttcagatgcactaatttctcttcaaatggtatatcctcgaaggaatctttca
gctgaccagtggagaaatgcccagttattgagcctcatcagtgcacctagtacaatgctt
aatccagcacagtccgacactatgccttgtgaatacctctctttggatgcaatggaaaag
tggattatctttggctttattttgtgccatgggatcctaaatactgacgctacagcactg
aacctttggaaactagctcttcaaagtagctcttgcctctctctctttcgggatgaagtt
ttccacattcacaaagctgcagaagacttatttgtaaacatacgaggctataataaacgt
attaatgacataagagaatgcaaggaggcagccgtgtcacatgctggttcaatgcacaga
gaaagacgcaagtttttaagatctgcactgaaggaattggctactgtcctctctgatcaa
cctggattgctaggtcccaaggcactttttgtttttatggcattatcctttgcccgtgat
gaaatcatctggctacttcgtcatgcagataacatgccaaagaagagtgcagacgacttt
atagataagcacattgctgaattaatattttacatggaagaacttagagcacatgtgagg
aaatacggacctgtaatgcagaggtattacgtgcagtacctttctggctttgatgctgtt
gtcctcaatgaactcgtgcagaatctttctgtttgccctgaagatgaatcaatcatcatg
tcctcttttgttaacactatgacttccctaagtgtaaaacaagttgaagatggggaagta
tttgatttcagaggaatgagattagattggtttaggttacaggcatatactagtgtctca
aaggcttcacttggccttgcagatcacagagaacttggaaagatgatgaatacaataatt
tttcatacaaaaatggtagattccttggtggaaatgttggtggaaacatcagatctctcc
atattttgtttttatagtcgtgcttttgagaagatgtttcaacagtgtttggagttaccc
tctcaatcaagatactcaattgcatttccactactttgcactcattttatgagttgcacg
catgaactatgtccagaagagcgacatcatattggagatcgcagtctttccttatgtaat
atgttcctagatgaaatggccaaacaagctcgaaatctcatcactgatatttgcacagaa
cagtgtacccttagtgaccagttgctacccaagcattgtgccaaaactatcagtcaagca
gtgaataagaaatcaaaaaagcagactggtaagaaaggggaacctgaaagggagaaacca
ggtgttgagagcatgaggaaaaacaggctggttgtgaccaaccttgataaattgcacact
gcactttctgagttatgcttctctataaattatgtaccaaacatggtggtatgggaacat
acctttaccccacgagaatatttgacttctcatctggaaatacgctttaccaagtcaatt
gttgggatgactatgtataatcaagccacacaggaaattgcaaaaccttcagaacttcta
acaagtgtaagagcatacatgaccgtactccagtcaatagaaaactatgtgcagattgat
attacaagagtatttaataatgtgcttcttcaacaaacacaacatttagacagtcatgga
gagccaaccattacaagtctatacacaaattggtatttggaaactttgttacgacaagtc
agcaatggccatatagcatattttcctgcaatgaaagcgtttgtgaacttacctacagaa
aatgaattaacattcaatgcagaggaatattctgacatatcagaaatgaggtcattatca
gaactactaggcccatatggtatgaagtttctaagtgaaagccttatgtggcatatttca
tcacaagttgctgaacttaagaaacttgtggtggagaatgttgatgtgttaacacaaatg
aggaccagctttgacaaaccagaccagatggctgcactgtttaaaagattatcatctgtt
gacagtgtcttgaagaggatgacaataattggtgtaattttatccttccgatcattggca
caagaagcacttagagatgtcttatcctaccacattccttttcttgtaagttcaattgaa
gattttaaggatcacattccaagggaaactgatatgaaggttgcaatgaatgtgtatgag
ttatcatcagctgccggattaccttgtgagattgatcctgcattggtcgtagctctttct
tcacaaaaatcggaaaacattagtccagaagaagagtataaaattgcctgccttctcatg
gtgtttgtggcagtttctttgccaacactggccagtaatgtgatgtctcagtacagccct
gctatagaagggcattgcaacaacatacattgcttggccaaagccatcaaccagattgct
gcagctttgtttacaattcacaaaggaagcattgaagaccgtcttaaagaatttctggcg
cttgcatcctccagtctactgaaaattggccaggagacagataaaactacaacaagaaat
agagaatctgtttatttactgctagatatgattgtacaagaatctccattccttacaatg
gatcttttggaatcttgttttccttatgtcttgctgagaaatgcataccatgctgtctac
aaacaaagtgttacatcttctgcataa

KEGG   Homo sapiens (human): 3071
Entry
3071              CDS       T01001                                 

Gene name
NCKAP1L, HEM1
Definition
(RefSeq) NCK associated protein 1 like
  KO
K05750  NCK-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses)
  Element
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3071 (NCKAP1L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    3071 (NCKAP1L)
   05132 Salmonella infection
    3071 (NCKAP1L)
SSDB
Motif
Pfam: Nckap1
Other DBs
NCBI-GeneID: 3071
NCBI-ProteinID: NP_005328
OMIM: 141180
HGNC: 4862
Ensembl: ENSG00000123338
Vega: OTTHUMG00000169843
Pharos: P55160(Tbio)
UniProt: P55160
Position
12q13.13-q13.2
AA seq 1127 aa
MSLTSAYQHKLAEKLTILNDRGQGVLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINK
KFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVDVMEFRDHVYELLNTIDACQCHFD
INLNFDFTRSYLDLIVTYTSVILLLSRIEDRRILIGMYNCAHEMLHGHGDPSFARLGQMV
LEYDHPLKKLTEEFGPHTKAVSGALLSLHFLFVRRNQGAEQWRSAQLLSLISNPPAMINP
ANSDTMACEYLSVEVMERWIIIGFLLCHGCLNSNSQCQKLWKLCLQGSLYITLIREDVLQ
VHKVTEDLFSSLKGYGKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKELETVLADEPG
LLGPKALFAFMALSFIRDEVTWLVRHTENVTKTKTPEDYADSSIAELLFLLEGIRSLVRR
HIKVIQQYHLQYLARFDALVLSDIIQNLSVCPEEESIIMSSFVSILSSLNLKQVDNGEKF
EFSGLRLDWFRLQAYTSVAKAPLHLHENPDLAKVMNLIVFHSRMLDSVEKLLVETSDLST
FCFHLRIFEKMFAMTLEESAMLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHGLHHCNS
FLEELAKQTSNCVLEICAEQRNLSEQLLPKHCATTISKAKNKKTRKQRQTPRKGEPERDK
PGAESHRKNRSIVTNMDKLHLNLTELALTMNHVYSFSVFEHTIFPSEYLSSHLEARLNRA
IVWLAGYNATTQEIVRPSELLAGVKAYIGFIQSLAQFLGADASRVIRNALLQQTQPLDSC
GEQTITTLYTNWYLESLLRQASSGTIILSPAMQAFVSLPREGEQNFSAEEFSDISEMRAL
AELLGPYGMKFLSENLMWHVTSQIVELKKLVVENMDILVQIRSNFSKPDLMASLLPQLTG
AENVLKRMTIIGVILSFRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIF
ELASAAGVGCDIDPALVAAIANLKADTSSPEEEYKVACLLLIFLAVSLPLLATDPSSFYS
IEKDGYNNNIHCLTKAIIQVSAALFTLYNKNIETHLKEFLVVASVSLLQLGQETDKLKTR
NRESISLLMRLVVEESSFLTLDMLESCFPYVLLRNAYREVSRAFHLN
NT seq 3384 nt   +upstreamnt  +downstreamnt
atgtctttgacatctgcttaccagcataaattagcagagaagctcactatcctgaatgat
cgcggtcagggggttctcatccgtatgtataacatcaagaagacttgttcagaccccaaa
tctaagccacctttcttactggaaaagtccatggaaccatctctcaagtatatcaacaag
aaatttcccaacatagatgtccgaaacagcacgcaacatttaggaccagtacatcgtgaa
aaagccgagataattagattcctcaccaactactaccagtcatttgtggatgtcatggaa
tttcgggatcatgtatatgaacttctcaacaccattgatgcctgccagtgccattttgat
atcaatctcaactttgatttcactcggagttacctggacttgattgtaacttacacctca
gtcattttacttctgtcacggattgaagatcggcggatactcattggcatgtacaattgt
gcccatgagatgctgcatgggcatggtgaccccagttttgcccgtctgggtcagatggtc
ttggagtatgaccaccctctgaagaagctgacagaagagtttgggcctcacacaaaggct
gtgagtggagccctcctctctttgcatttcctctttgtccgaagaaaccagggggctgag
cagtggcgcagtgcccaacttctaagcctcatcagcaaccccccagccatgattaaccct
gctaattcagatacaatggcctgtgagtatctgtctgtggaagtaatggagcgctggatt
atcattgggtttcttctttgtcatgggtgcctcaactccaatagccagtgccagaagctg
tggaagctgtgtctgcagggctccctctacatcacccttatccgtgaggatgtgctgcag
gtgcacaaagtcaccgaggacctgtttagcagtttgaaagggtatggcaagagagtggca
gacataaaggagagcaaggaacatgtaattgcaaacagtggccagtttcattgtcaacgg
cggcaatttctgcggatggcagtgaaggagctggagactgtgttggctgatgaaccggga
ctactgggtcctaaggctctttttgctttcatggccctgtccttcattcgtgatgaggtc
acctggctggttcgccacacagagaatgtcaccaagacaaagacacctgaggactatgct
gactcgagcattgcagagctacttttcttgttggaggggattaggtctctggtccgaaga
cacatcaaagtgatacagcaataccaccttcagtacttggcaagatttgatgctcttgtg
ctcagtgacatcattcagaacttgtctgtgtgtccagaggaggagtccatcatcatgtcc
tcattcgtcagtatcctctcctctctgaatctcaaacaagttgataatggagaaaaattt
gaattctcaggattgaggctggactggttccgcctacaggcatacactagcgtggctaag
gcccctctgcacctgcatgagaaccctgacttagccaaggtgatgaacctcattgtcttc
cactcccgaatgctggactccgtagaaaaattgctggtggaaacttctgatctgtctact
ttctgctttcatcttcgtatctttgagaagatgtttgccatgaccttggaggaatctgcc
atgttgcgttatgccattgctttccccctgatttgtgctcactttgtccactgcactcat
gagatgtgcccagaggagtacccccacctcaagaaccatggtcttcaccactgcaactcc
ttcctggaagagttggccaagcagaccagcaattgcgtcctggagatctgtgctgagcag
cgaaacctgagcgagcagcttctacctaagcactgtgccactacaatcagcaaagccaag
aacaagaaaaccaggaagcagaggcagactcccagaaaaggagagcccgagagggacaag
ccaggagctgagagtcaccggaagaaccgcagcattgtcaccaacatggacaagctacac
ctaaacttgacagaactggcactgacaatgaatcatgtatacagtttctccgtgtttgaa
catactatcttcccttctgagtacctcagcagccacctggaggccagactcaacagagcc
attgtgtggctggctggctacaatgccacgacccaggagatcgtacggccttctgagctg
ttggcaggagtcaaagcatacattggtttcatacagtcactggcccagtttttgggtgca
gatgcttccagagtcatccgcaacgccctcctgcagcagacacaaccactggattcctgt
ggggaacagacaatcaccacactctacacaaactggtacctggaaagtctgcttagacag
gcaagcagtgggaccatcatcctctccccagccatgcaggccttcgtcagcctgcccaga
gaaggggagcagaacttcagtgcagaggagttctctgacatctctgagatgcgggccttg
gcagaactcctgggcccctatggcatgaagttcctgagtgaaaacctgatgtggcatgtg
acctctcagattgtggagctgaagaagctggtggtggaaaacatggacatacttgttcag
atcagatccaactttagcaagccggacttgatggcttccctgctgccccagctgacaggg
gctgaaaatgtgctaaagcgcatgaccatcattggggttatcctcagtttcagggccatg
gcccaagagggacttcgggaggttttctcctcccactgcccatttcttatgggtcccatt
gagtgcttgaaggagtttgtcactccagacacagacatcaaggtgaccttgagtatcttt
gagctggcatctgctgcaggtgtgggctgtgacattgacccagccttggtggctgccatt
gctaatctgaaagctgatacttcatctcctgaggaggaatataaggtggcctgcctgctc
ttgatctttctggcagtttccctcccactccttgccactgacccttcttccttttatagc
attgagaaggatggttacaacaacaatattcattgcttgaccaaagccatcatccaggtg
tctgctgccctcttcacgctctacaacaagaacattgaaactcacctcaaggaatttctg
gtggtggcctctgtcagcctcttgcagctgggccaggagactgacaagcttaaaaccaga
aatcgagaatccatttctctgctcatgcgcttggtggtggaggagtcatccttcctgacc
ctggacatgctggagtcctgtttcccttatgtcctgcttcgaaatgcctatcgggaggtg
tctcgggccttccacctaaactga

DBGET integrated database retrieval system