KEGG   Homo sapiens (human): 107987462
Entry
107987462         CDS       T01001                                 

Definition
(RefSeq) leukocyte immunoglobulin-like receptor subfamily B member 3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig RCSD
Other DBs
NCBI-GeneID: 107987462
NCBI-ProteinID: XP_016885786
UniProt: O75022
Position
19
AA seq 631 aa
MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRL
HKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGA
YSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQAL
FPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQS
LTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAH
NLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEG
AAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSG
HSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLRRQRHSKHRTSDQRKT
DFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQSPHDEDPQA
VTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLHS
LTLRRKATEPPPSQEGEPPAEPSIYATLAIH
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgacgcccgccctcacagccctgctctgccttgggctgagtctgggccccaggacccgc
gtgcaggcagggcccttccccaaacccaccctctgggctgagccaggctctgtgatcagc
tgggggagccccgtgaccatctggtgtcaggggagccaggaggcccaggagtaccgactg
cataaagagggaagcccagagcccttggacagaaataacccactggaacccaagaacaag
gccagattctccatcccatccatgacagagcaccatgcagggagataccgctgccactat
tacagctctgcaggctggtcagagcccagcgaccccctggagatggtgatgacaggagcc
tacagcaaacccaccctctcagccctgcccagccctgtggtggcctcaggggggaatatg
accctccgatgtggctcacagaagggatatcaccattttgttctgatgaaggaaggagaa
caccagctcccccggaccctggactcacagcagctccacagtcgggggttccaggccctg
ttccctgtgggccccgtgacccccagccacaggtggaggttcacatgctattactattat
acaaacaccccctgggtgtggtcccaccccagtgaccccctggagattctgccctcaggc
gtgtctaggaagccctccctcctgaccctgcagggccctgtcctggcccctgggcagagc
ctgaccctccagtgtggctctgatgtcggctacaacagatttgttctgtataaggagggg
gaacgtgacttcctccagcgccctggccagcagccccaggctgggctctcccaggccaac
ttcaccctgggccctgtgagcccctccaatgggggccagtacaggtgctacggtgcacac
aacctctcctccgagtggtcggcccccagcgaccccctgaacatcctgatggcaggacag
atctatgacaccgtctccctgtcagcacagccgggccccacagtggcctcaggagagaac
gtgaccctgctgtgtcagtcatggtggcagtttgacactttccttctgaccaaagaaggg
gcagcccatcccccactgcgtctgagatcaatgtacggagctcataagtaccaggctgaa
ttccccatgagtcctgtgacctcagcccacgcggggacctacaggtgctacggctcatac
agctccaacccccacctgctgtctcaccccagtgagcccctggagctcgtggtctcagga
cactctggaggctccagcctcccacccacagggccgccctccacacctggtctgggaaga
tacctggaggttttgattggggtctcggtggccttcgtcctgctgctcttcctcctcctc
ttcctcctcctccgacgtcagcgtcacagcaaacacaggacatctgaccagagaaagact
gatttccagcgtcctgcaggggctgcggagacagagcccaaggacaggggcctgctgagg
aggtccagcccagctgctgacgtccaggaagaaaacctctatgctgccgtgaaggacaca
cagtctgaggacagggtggagctggacagtcagagcccacacgatgaagacccccaggca
gtgacgtatgccccggtgaaacactccagtcctaggagagaaatggcctctcctccctcc
tcactgtctggggaattcctggacacaaaggacagacaggtggaagaggacaggcagatg
gacactgaggctgctgcatctgaagcctcccaggatgtgacctacgcccagctgcacagc
ttgacccttagacggaaggcaactgagcctcctccatcccaggaaggggaacctccagct
gagcccagcatctacgccactctggccatccactag

DBGET integrated database retrieval system