KEGG   Homo sapiens (human): 108Help
Entry
108               CDS       T01001                                 

Gene name
ADCY2, AC2, HBAC2
Definition
(RefSeq) adenylate cyclase 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa01522  Endocrine resistance
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04727  GABAergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
hsa05032  Morphine addiction
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06124  Chemokine signaling (viruses)
nt06167  Human cytomegalovirus (HCMV)
nt06310  CRH-ACTH-cortisol signaling
nt06318  CaSR-PTH signaling
nt06322  TRH-TSH-TH signaling
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
nt06324  GHRH-GH-IGF signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00289  Mutation-inactivated GNAS to PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00785  Mutation-inactivated PAX8 to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
N00885  LHCGR-GNAS-PKA signaling pathway
N00886  Mutation-activated LHCGR to LHCGR-GNAS-PKA signaling pathway
N00910  GHRHR-PKA-GH signaling pathway
N00911  Mutation-inactivated GHRHR to GHRHR-PKA-GH signaling pathway
N00912  Mutation-activated GNAS to GHRHR-PKA-GH signaling pathway
N00922  FSHR-GNAS-PKA signaling pathway
N00923  Mutation-inactivated FSHB to FSHR-GNAS-PKA signaling pathway
Drug target
Colforsin (DG02877): D01697 D03584
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108 (ADCY2)
   04371 Apelin signaling pathway
    108 (ADCY2)
   04020 Calcium signaling pathway
    108 (ADCY2)
   04072 Phospholipase D signaling pathway
    108 (ADCY2)
   04024 cAMP signaling pathway
    108 (ADCY2)
   04022 cGMP-PKG signaling pathway
    108 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108 (ADCY2)
   04062 Chemokine signaling pathway
    108 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    108 (ADCY2)
   04922 Glucagon signaling pathway
    108 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    108 (ADCY2)
   04912 GnRH signaling pathway
    108 (ADCY2)
   04913 Ovarian steroidogenesis
    108 (ADCY2)
   04915 Estrogen signaling pathway
    108 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    108 (ADCY2)
   04921 Oxytocin signaling pathway
    108 (ADCY2)
   04926 Relaxin signaling pathway
    108 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    108 (ADCY2)
   04918 Thyroid hormone synthesis
    108 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    108 (ADCY2)
   04916 Melanogenesis
    108 (ADCY2)
   04925 Aldosterone synthesis and secretion
    108 (ADCY2)
   04927 Cortisol synthesis and secretion
    108 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108 (ADCY2)
   04270 Vascular smooth muscle contraction
    108 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    108 (ADCY2)
   04971 Gastric acid secretion
    108 (ADCY2)
   04972 Pancreatic secretion
    108 (ADCY2)
   04976 Bile secretion
    108 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    108 (ADCY2)
   04727 GABAergic synapse
    108 (ADCY2)
   04725 Cholinergic synapse
    108 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    108 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    108 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    108 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108 (ADCY2)
   04714 Thermogenesis
    108 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    108 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    108 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108 (ADCY2)
   05163 Human cytomegalovirus infection
    108 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108 (ADCY2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108 (ADCY2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Motif
Other DBs
NCBI-GeneID: 108
NCBI-ProteinID: NP_065433
OMIM: 103071
HGNC: 233
Ensembl: ENSG00000078295
Vega: OTTHUMG00000090476
Pharos: Q08462(Tbio)
UniProt: Q08462 Q71UM8
Position
5p15.31
AA seq 1091 aa AA seqDB search
MWQEAMRRRRYLRDRSEEAAGGGDGLPRSRDWLYESYYCMSQQHPLIVFLLLIVMGSCLA
LLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICLVAM
GYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSAT
PGGKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQ
ERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFT
RLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVK
MGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGG
VPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPR
HTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTL
RTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAF
KYYVTCACLIFFCIFIVQILVLPKTSVLGISFGAAFLLLAFILFVCFAGQLLQCSKKASP
LLMWLLKSSGIIANRPWPRISLTIITTAIILMMAVFNMFFLSDSEETIPPTANTTNTSFS
ASNNQVAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHT
HAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKK
EREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFY
TESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHS
QEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDI
WGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEM
SRSLSQSNVAS
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggaggcgatgcggcgccgccgctacctgcgggaccgctccgaggaggcggcg
ggcggcggagacgggctgccgcggtcccgggactggctctacgagtcctactactgcatg
agccagcagcacccgctcatcgtcttcctgctgctcatcgtcatgggctcctgcctcgcc
ctgctcgccgtcttcttcgcgctcgggctggaagttgaagaccatgtggcgtttctaata
acagttccaactgccctggcgattttctttgcgatatttatcctggtctgcatcgagtct
gtgtttaagaagctgctgcgcctcttctcgttggtgatatggatatgccttgttgccatg
ggatacctgttcatgtgttttggaggcaccgtctctccctgggaccaggtatcgttcttc
ctcttcatcatcttcgtggtgtacaccatgctgcccttcaacatgcgagacgccatcatt
gccagcgtcctcacctcctcctcccacaccatcgtgcttagcgtctgcctgtctgcaaca
ccgggaggcaaggagcacctggtctggcagatcctggccaatgtgatcattttcatctgt
gggaacctggcgggagcctaccataagcacctcatggaactcgctcttcagcaaacatat
caggacacctgtaattgcatcaagtcgcggatcaagttggaatttgaaaaacgtcaacag
gagcggcttctgctctccctgctgccggcccacatcgccatggagatgaaagcggagatc
atccagaggctgcagggccccaaggcgggccagatggagaacacaaataacttccacaac
ctgtatgtgaagcggcatacaaacgtgagcatcttatacgctgacatcgttggctttacc
cggctggcaagtgactgctccccgggagaactagtccacatgctgaatgagctctttgga
aagtttgatcaaattgcaaaggagaatgaatgcatgagaattaaaattttaggagactgc
tactactgtgtatctggactccctatatctctccctaaccatgccaagaactgtgtgaaa
atggggctggacatgtgtgaagccataaagaaagtgagggatgctactggagttgatatc
aacatgcgcgtgggcgtgcattctgggaatgtcctgtgtggcgtgattggtctgcagaag
tggcaatatgatgtgtggtcacatgatgtgaccttggccaaccacatggaagctggaggg
gtccctggacgtgttcacatttcttctgtcaccctggagcacttgaatggcgcttataaa
gtggaggagggagatggtgacattagggacccatatttaaaacagcacctggtgaaaacc
tactttgtgatcaaccccaagggagaacgacggagcccccagcatctcttcagacctcgc
cacacccttgatggagccaaaatgagggcctcggtccgcatgacccggtacttggagtcc
tggggggcagccaagccctttgcacacctacatcacagggacagcatgaccacagagaac
ggcaagatcagcaccacggatgtacccatgggtcagcataattttcaaaatcgcacctta
agaaccaagtcacaaaagaagagatttgaagaagaattgaatgaaaggatgattcaagca
attgatgggattaatgcacagaagcaatggctcaagtctgaagacattcagagaatctca
ctgcttttctataacaaagtactagaaaaagagtaccgggccacggcactgccagcgttc
aagtattatgtgacttgtgcctgtctcatattcttctgcatcttcattgtgcagattctc
gtgctgccaaaaacgtccgtcctgggcatctcctttggggctgcgtttctcttgctggcc
ttcatcctcttcgtctgctttgctggacagcttctgcaatgcagcaaaaaagcctctccc
ctgctcatgtggcttttgaagtcctcgggcatcattgccaaccgcccctggccacggatc
tctctcacgatcatcaccacagccatcatattaatgatggccgtgttcaacatgtttttc
ctgagtgactcagaggaaacaatccctccaactgccaacacaacaaacacaagcttttca
gcctcaaataatcaggtggcgattctgcgtgcgcagaatttatttttcctcccgtacttt
atctacagctgcattctgggactgatatcctgttccgtgttcctgcgggtaaactatgag
ctgaagatgttgatcatgatggtggccttggtgggctacaacaccatcctactccacacc
cacgcccacgtcctgggcgactacagccaggtcttatttgagagaccaggcatttggaaa
gacctgaagaccatgggctctgtgtctctctctatattcttcatcacactgcttgttctg
ggtagacagaatgaatattactgtaggttagacttcttatggaagaacaaattcaaaaaa
gagcgggaggagatagagaccatggagaacctgaaccgcgtgctgctggagaacgtgctt
cccgcgcacgtggctgagcacttcctggccaggagcctgaagaatgaggagctataccac
cagtcctatgactgcgtctgcgtcatgtttgcctccattccggatttcaaagaattttat
acagaatccgacgtgaacaaggagggcttggaatgccttcggctcctgaacgagatcatc
gctgactttgatgatcttctttccaagccaaaattcagtggagttgaaaagattaagacc
attggcagcacatacatggcagcaacaggtctgagcgctgtgcccagccaggagcactcc
caggagcccgagcggcagtacatgcacattggcaccatggtggagtttgcttttgccctg
gtagggaagctggatgccatcaacaagcactccttcaacgacttcaaattgcgagtgggt
attaaccatggacctgtgatagctggtgtgattggagctcagaagccacaatatgatatc
tggggcaacactgtcaatgtggccagtaggatggacagcaccggagtcctggacaaaata
caggttaccgaggagacgagcctcgtcctgcagaccctcggatacacgtgcacctgtcga
ggaataatcaacgtgaaaggaaagggggacctgaagacgtactttgtaaacacagaaatg
tcaaggtccctttcccagagcaacgtggcatcctga

DBGET integrated database retrieval system