KEGG   Homo sapiens (human): 10801
Entry
10801             CDS       T01001                                 

Gene name
SEPTIN9, AF17q25, MSF, MSF1, NAPB, PNUTL4, SEPT9, SINT1, SeptD1
Definition
(RefSeq) septin 9
  KO
K16938  septin 3/9/12
Organism
hsa  Homo sapiens (human)
Pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
Disease
H01131  Hereditary neuralgic amyotrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    10801 (SEPTIN9)
   05100 Bacterial invasion of epithelial cells
    10801 (SEPTIN9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10801 (SEPTIN9)
   04147 Exosome [BR:hsa04147]
    10801 (SEPTIN9)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 1
     10801 (SEPTIN9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10801 (SEPTIN9)
SSDB
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 GTP_EFTU Dynamin_N Roc Ras FtsK_SpoIIIE AAA_16 AAA_22 ABC_tran G-alpha IIGP NB-ARC AAA_24 AAA_29 PduV-EutP AAA_7 VirE Arf P-loop_TraG AAA_14 Sigma54_activat
Other DBs
NCBI-GeneID: 10801
NCBI-ProteinID: NP_001106963
OMIM: 604061
HGNC: 7323
Ensembl: ENSG00000184640
Vega: OTTHUMG00000177327
Pharos: Q9UHD8(Tbio)
UniProt: Q9UHD8
Structure
PDB: 
5CYO 4YQF 5CYP

Position
17q25.3
AA seq 586 aa
MKKSYSGGTRTSSGRLRRLGDSSGPALKRSFEVEEVETPNSTPPRRVQTPLLRATVASST
QKFQDLGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVE
NAGAIGPSRFGLKRAEVLGHKTPEPAPRRTEITIVKPQESAHRRMEPPASKVPEVPTAPA
TDAAPKRVEIQMPKPAEAPTAPSPAQTLENSEPAPVSQLQSRLEPKPQPPVAEATPRSQE
ATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFN
IMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTV
IDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGH
SLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHFKQRITADLLSNGIDVYPQKEFDE
DSEDRLVNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYLRDLL
IRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEKEPEAPEM
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgaagaagtcttactcaggaggcacgcggacctccagtggccggctccggaggcttggt
gactccagtggcccagccttgaaaagatcttttgaggtcgaggaggtcgagacacccaac
tccaccccaccccggagggtccagactcccctactccgagccactgtggccagctccacc
cagaaattccaggacctgggcgtgaagaactcagaaccctcggcccgccatgtggactcc
ctaagccaacgctcccccaaggcgtccctgcggagggtggagctctcgggccccaaggcg
gccgagccggtgtcccggcgcactgagctgtccattgacatctcgtccaagcaggtggag
aacgccggggccatcggcccgtcccggttcgggctcaagagggccgaggtgttgggccac
aagacgccagaaccggcccctcggaggacggagatcaccatcgtcaaaccccaggagtca
gcccaccggaggatggagccccctgcctccaaggtccccgaggtgcccactgcccctgcc
accgacgcagcccccaagagggtggagatccagatgcccaagcctgctgaggcgcccacc
gcccccagcccagcccagaccttggagaattcagagcctgcccctgtgtctcagctgcag
agcaggctggagcccaagccccagccccctgtggctgaggctacaccccggagccaggag
gccactgaggcggctcccagctgcgttggcgacatggccgacacccccagagatgccggg
ctcaagcaggcgcctgcatcacggaacgagaaggccccggtggacttcggctacgtgggg
attgactccatcctggagcagatgcgccggaaggccatgaagcagggcttcgagttcaac
atcatggtggtcgggcagagcggcttgggtaaatccaccttaatcaacaccctcttcaaa
tccaaaatcagccggaagtcggtgcagcccacctcagaggagcgcatccccaagaccatc
gagatcaagtccatcacgcacgatattgaggagaaaggcgtccggatgaagctgacagtg
attgacacaccagggttcggggaccacatcaacaacgagaactgctggcagcccatcatg
aagttcatcaatgaccagtacgagaaatacctgcaggaggaggtcaacatcaaccgcaag
aagcgcatcccggacacccgcgtccactgctgcctctacttcatccccgccaccggccac
tccctcaggcccctggacatcgagtttatgaaacgcctgagcaaggtggtcaacatcgtc
cctgtcatcgccaaggcggacacactcaccctggaggagagggtccacttcaaacagcgg
atcaccgcagacctgctgtccaacggcatcgacgtgtacccccagaaggaatttgatgag
gactcggaggaccggctggtgaacgagaagttccgggagatgatcccatttgctgtggtg
ggcagtgaccacgagtaccaggtcaacggcaagaggatccttgggaggaagaccaagtgg
ggtaccatcgaagttgaaaacaccacacactgtgagtttgcctacctgcgggaccttctc
atcaggacgcacatgcagaacatcaaggacatcaccagcagcatccacttcgaggcgtac
cgtgtgaagcgcctcaacgagggcagcagcgccatggccaacggcatggaggagaaggag
ccagaagccccggagatgtag

KEGG   Homo sapiens (human): 124404
Entry
124404            CDS       T01001                                 

Gene name
SEPTIN12, SEPT12, SPGF10
Definition
(RefSeq) septin 12
  KO
K16938  septin 3/9/12
Organism
hsa  Homo sapiens (human)
Pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
Disease
H01282  Spermatogenic failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    124404 (SEPTIN12)
   05100 Bacterial invasion of epithelial cells
    124404 (SEPTIN12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    124404 (SEPTIN12)
   04147 Exosome [BR:hsa04147]
    124404 (SEPTIN12)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 1
     124404 (SEPTIN12)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   124404 (SEPTIN12)
SSDB
Motif
Pfam: Septin MMR_HSR1 AIG1 RsgA_GTPase FtsK_SpoIIIE Dynamin_N Roc AAA_16 AAA_22 FeoB_N Ras IIGP AAA_32 ABC_tran VirE AAA_29 NB-ARC AAA_7 P-loop_TraG AAA_24 Sigma54_activat
Other DBs
NCBI-GeneID: 124404
NCBI-ProteinID: NP_653206
OMIM: 611562
HGNC: 26348
Ensembl: ENSG00000140623
Vega: OTTHUMG00000129481
Pharos: Q8IYM1(Tbio)
UniProt: Q8IYM1
Structure
PDB: 
6MQB

Position
16p13.3
AA seq 358 aa
MDPLRRSPSPCLSSQPSSPSTPPCEMLGPVGIEAVLDQLKIKAMKMGFEFNIMVVGQSGL
GKSTMVNTLFKSKVWKSNPPGLGVPTPQTLQLHSLTHVIEEKGVKLKLTVTDTPGFGDQI
NNDNCWDPILGYINEQYEQYLQEEILITRQRHIPDTRVHCCVYFVPPTGHCLRPLDIEFL
QRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFDEDINDKILNSK
LRDRIPFAVVGADQEHLVNGRCVLGRKTKWGIIEVENMAHCEFPLLRDLLIRSHLQDLKD
ITHNIHYENYRVIRLNESHLLPRGPGWVNLAPASPGQLTTPRTFKVCRGAHDDSDDEF
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggaccccctgaggcgctccccctctccctgcctgtcctcgcagccctccagccccagc
accccaccctgcgagatgcttggtcctgtgggcattgaggctgtgctggaccagctgaag
atcaaggctatgaagatggggtttgagttcaacatcatggtggtggggcaaagcgggctg
ggcaagtccacgatggtgaacacgctgttcaagtccaaagtgtggaagtcaaacccaccg
ggcttgggggtgcccacaccccagacgctgcagctgcattcactgacccatgtcatagag
gagaagggtgtgaagctgaagctgacggtgacggacacgcccggcttcggggaccagatc
aacaatgacaactgctgggaccccatcctgggctacatcaacgagcaatacgagcagtac
ctgcaggaggagatcctcatcacccgccagcgccacatcccagacacccgggtgcactgc
tgcgtgtactttgtaccacccactgggcactgcctgcggcccctggacattgagttcctg
cagcggctgtgccggactgtgaatgtggtgcccgtgattgccagggccgacagcctgacc
atggaggagcgagaggccttcaggcgcaggatccagcagaacctgaggacccactgcatc
gacgtctacccccagatgtgctttgacgaggacatcaatgacaaaatcctcaacagcaag
ttacgggaccgaatcccttttgccgtggtaggggctgaccaagagcacctggtgaacggg
aggtgtgtcctgggccggaagaccaagtggggcatcattgaagtggagaacatggcgcac
tgtgaatttcctctcctgagagacctgcttatccgctcccacctccaagacctgaaggac
ataacccacaacatccactatgagaactaccgcgtcatcagactcaatgaaagccacctg
ctgccccgcgggcccggctgggtgaacctggccccggcctccccaggacagctgaccacc
ccccggaccttcaaggtctgcaggggggcccatgacgattctgatgatgagttctga

KEGG   Homo sapiens (human): 1731
Entry
1731              CDS       T01001                                 

Gene name
SEPTIN1, DIFF6, LARP, PNUTL3, SEP1, SEPT1
Definition
(RefSeq) septin 1
  KO
K13737  septin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    1731 (SEPTIN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    1731 (SEPTIN1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     1731 (SEPTIN1)
SSDB
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase GTP_EFTU AAA_23 VirE AAA_22 AIG1 Roc AAA_16 ABC_tran Ras AAA_29 IIGP Pet20 AAA_7
Other DBs
NCBI-GeneID: 1731
NCBI-ProteinID: NP_443070
OMIM: 612897
HGNC: 2879
Ensembl: ENSG00000180096
Vega: OTTHUMG00000176984
Pharos: Q8WYJ6(Tdark)
UniProt: Q8WYJ6 J3KNL2
Position
16p11.2
AA seq 372 aa
MAGGVMDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQ
VPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFE
QYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADAL
MPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVR
DGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQ
SLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQ
QSQAQGEQSDAL
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctggcggagtcatggacaaggagtacgtgggttttgctgccctccccaaccagctg
caccgcaagtctgtcaagaaggggtttgacttcacgctaatggtggcaggggagtcaggc
ctagggaaatccaccctcatcaacagcctcttcctcaccaacctctatgaggatcgccag
gtgccagaggccagtgctcgcttgacacagaccctggccattgagcgccggggcgtagag
attgaggaagggggtgtgaaagtgaagctgacccttgtggacacacctggctttggggac
tcagtggactgctctgactgctggcttccggtggtgaaattcatcgaggagcaatttgag
cagtaccttagggatgagagtggcctgaaccggaagaacatccaggactcccgagtccac
tgctgcctctacttcatctcacccttcggccgggggctccggcccctagatgtggccttc
ctccgggcagtacacgagaaagtcaacatcatcccagtcattggcaaagcggatgctctg
atgccccaggaaacccaggccctcaagcagaagatccgggatcagttgaaggaagaggag
atccacatctaccagttccccgaatgtgactctgatgaagatgaagacttcaagaggcag
gatgcagagatgaaggaaagcatcccttttgcagtcgtgggatcatgcgaggtggtgagg
gatggcgggaaccggccggtgaggggacgccgctactcctgggggaccgtggaggtggag
aacccacatcactgcgatttcctgaacctgcgacggatgctggtgcagacacacctgcag
gacctgaaagaggtgacgcacgatctgctctacgagggctaccgggcccgctgcctacag
agcctggcccggcctggggctcgcgatcgagccagccgcagtaagctttcccgccagagc
gccacagagatcccgctgcccatgctgcctctggcggacaccgagaagctgatccgcgag
aaagacgaagagctgcgccgcatgcaagagatgctggagaagatgcaggcccaaatgcag
cagagccaggcccagggcgagcagtcagacgccctctga

KEGG   Homo sapiens (human): 23157
Entry
23157             CDS       T01001                                 

Gene name
SEPTIN6, SEP2, SEPT2, SEPT6
Definition
(RefSeq) septin 6
  KO
K16939  septin 6/8/11
Organism
hsa  Homo sapiens (human)
Pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    23157 (SEPTIN6)
   05100 Bacterial invasion of epithelial cells
    23157 (SEPTIN6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    23157 (SEPTIN6)
   04147 Exosome [BR:hsa04147]
    23157 (SEPTIN6)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 1
     23157 (SEPTIN6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   23157 (SEPTIN6)
SSDB
Motif
Pfam: Septin MMR_HSR1 AAA_22 AAA_16 Roc AAA_29 IMD DUF2959 AAA_7 Atg14 Glucan_synthase TPR_MLP1_2 ABC_tran RsgA_GTPase Fzo_mitofusin Exonuc_VII_L
Other DBs
NCBI-GeneID: 23157
NCBI-ProteinID: NP_055944
OMIM: 300683
HGNC: 15848
Ensembl: ENSG00000125354
Vega: OTTHUMG00000022280
Pharos: Q14141(Tbio)
UniProt: Q14141
Structure
PDB: 
2QAG

Position
Xq24
AA seq 434 aa
MAATDIARQVGEGCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMD
TLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVE
FIDAQFEAYLQEELKIRRVLHTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNII
PIIAKADAISKSELTKFKIKITSELVSNGVQIYQFPTDDESVAEINGTMNAHLPFAVIGS
TEELKIGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIRVNMEDLREQTHTRHYELYRR
CKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRVKEKEAELKEA
EKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELLQSQGSQAGGSQTLK
RDKEKKNNPWLCTE
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggcagcgaccgatatagctcgccaggtgggtgaaggttgccgaactgtccccctggct
ggacatgtggggtttgacagcttgcctgaccagctggtgaataagtccgtcagccagggc
ttctgcttcaacatcctgtgcgtgggagagacaggtttgggcaagtccaccctcatggac
accctgttcaacaccaaattcgaaggggagccagccacccacacacagccgggtgtccag
ctccagtctaatacctatgacctccaagagagcaacgtgaggctaaagctcacgatcgtt
agcacagttggctttggggaccagatcaacaaagaggacagctacaagcctatcgtggaa
ttcatcgatgcacaattcgaggcctacctgcaggaagagctaaagatccgaagagtgcta
cacacctaccatgactcccgaatccatgtctgcttgtatttcattgcccccacgggtcat
tccctgaagtctctggacctagtgactatgaagaagctggacagtaaggtgaacatcatc
cccatcattgccaaagcagatgccatttcgaagagtgagctaacaaagttcaaaatcaaa
atcaccagcgagcttgtcagcaacggagtccagatctatcagtttcctacagatgatgag
tcggtggcagagatcaatggaaccatgaacgcccacctgccgtttgctgtcattggcagc
acagaagaactgaagataggcaacaagatgatgagggcgcggcagtatccttggggcact
gtgcaggttgaaaacgaggcccactgcgactttgtgaagctgcgggagatgctgattcgg
gtcaacatggaggatctgcgggagcagacccacacccggcactatgagctgtatcgccgc
tgtaagctggaggagatgggcttcaaggacaccgaccctgacagcaaacccttcagttta
caggagacatatgaggccaaaaggaacgagttcctaggggaactccagaaaaaagaagag
gagatgagacagatgttcgtccagcgagtcaaagagaaagaagcggagctcaaagaggca
gagaaagagctgcacgagaagtttgaccgtctgaagaaactgcaccaggacgagaagaag
aaactggaggataagaagaaatccctggatgatgaagtgaatgctttcaagcaaagaaag
acggcggctgagctgctccagtcccagggctcccaggctggaggctcacagactctgaag
agagacaaagagaagaaaaataatccatggctgtgtactgaatag

KEGG   Homo sapiens (human): 23176
Entry
23176             CDS       T01001                                 

Gene name
SEPTIN8, SEP2, SEPT8
Definition
(RefSeq) septin 8
  KO
K16939  septin 6/8/11
Organism
hsa  Homo sapiens (human)
Pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    23176 (SEPTIN8)
   05100 Bacterial invasion of epithelial cells
    23176 (SEPTIN8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    23176 (SEPTIN8)
   04147 Exosome [BR:hsa04147]
    23176 (SEPTIN8)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 1
     23176 (SEPTIN8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   23176 (SEPTIN8)
SSDB
Motif
Pfam: Septin MMR_HSR1 AAA_22 Roc AAA_16 RsgA_GTPase AAA_7 Ras RNA_helicase AIG1 ABC_tran AAA_24 IMD AAA_29 Atg14 DUF87
Other DBs
NCBI-GeneID: 23176
NCBI-ProteinID: NP_001092281
OMIM: 608418
HGNC: 16511
Ensembl: ENSG00000164402
Vega: OTTHUMG00000059735
Pharos: Q92599(Tbio)
UniProt: Q92599
Position
5q31.1
AA seq 483 aa
MAATDLERFSNAEPEPRSLSLGGHVGFDSLPDQLVSKSVTQGFSFNILCVGETGIGKSTL
MNTLFNTTFETEEASHHEACVRLRPQTYDLQESNVQLKLTIVDAVGFGDQINKDESYRPI
VDYIDAQFENYLQEELKIRRSLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVN
IIPIIAKADTISKSELHKFKIKIMGELVSNGVQIYQFPTDDEAVAEINAVMNAHLPFAVV
GSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELY
RRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELK
EKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQP
LRKDKDKKNRSDIGAHQPGMSLSSSKVMMTKASVEPLNCSSWWPAIQCCSCLVRDATWRE
GFL
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggcggccaccgacctggagcgcttctcgaatgcagagccagagccccggagcctctcc
ctgggcggccatgtgggtttcgacagcctccccgaccagctggtcagcaagtcggtcact
cagggcttcagcttcaacatcctctgtgtgggggagaccggcattggcaaatccacactg
atgaacacactcttcaacacgaccttcgagactgaggaagccagtcaccatgaggcatgc
gtgcgcctgcggccccagacctatgacctccaggagagcaacgtgcagctcaagctgacc
attgtggatgccgtgggctttggggatcagatcaataaggatgagagttacaggcccata
gttgactacatcgatgcgcagtttgaaaattatctgcaggaggagctgaagatccgccgc
tcgctcttcgactaccatgacacaaggatccacgtttgcctctacttcatcacgcccaca
gggcactccctgaagtctctagatctagtgaccatgaagaaactagacagcaaggtgaac
attattcccatcatcgccaaggctgacaccatctccaagagcgagctccacaagttcaag
atcaagatcatgggcgagttggtcagcaacggggtccagatctaccagttccccacggat
gatgaggctgttgcagagattaacgcagtcatgaatgcacatctgccctttgccgtggtg
ggcagcaccgaggaggtgaaggtggggaacaagctggtccgagcacggcagtacccctgg
ggagtggtgcaggtggagaatgagaatcactgcgacttcgtgaagctgcgggagatgttg
atccgggtgaacatggaagacctccgcgagcagacccacagccggcactacgagctctac
cggcgctgcaagttggaggagatgggctttcaggacagcgatggtgacagccagcccttc
agcctacaagagacatacgaggccaagaggaaggagttcctaagtgagctgcagaggaag
gaggaagagatgaggcagatgtttgtcaacaaagtgaaggagacagagctggagctgaag
gagaaggaaagggagctccatgagaagtttgagcacctgaagcgggtccaccaggaggag
aagcgcaaggtggaggaaaagcgccgggaactggaggaggagaccaacgccttcaatcgc
cggaaggctgcggtggaggccctgcagtcgcaggccttgcacgccacctcgcagcagccc
ctgaggaaggacaaggacaagaagaacagatcagatataggagcacaccagccgggcatg
agcctctccagctctaaggtgatgatgaccaaggccagtgtggagcccttgaactgcagc
agctggtggcccgccatacagtgctgcagctgcctggtcagggatgcgacgtggagggaa
ggattcctctga

KEGG   Homo sapiens (human): 4735
Entry
4735              CDS       T01001                                 

Gene name
SEPTIN2, DIFF6, NEDD-5, NEDD5, Pnutl3, SEPT2, hNedd5
Definition
(RefSeq) septin 2
  KO
K16942  septin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    4735 (SEPTIN2)
   05100 Bacterial invasion of epithelial cells
    4735 (SEPTIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4735 (SEPTIN2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4735 (SEPTIN2)
   04147 Exosome [BR:hsa04147]
    4735 (SEPTIN2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    4735 (SEPTIN2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     4735 (SEPTIN2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4735 (SEPTIN2)
SSDB
Motif
Pfam: Septin MMR_HSR1 GTP_EFTU RsgA_GTPase AIG1 Ras AAA_16 Dynamin_N AAA_22 Roc VirE AAA_29 ABC_tran AAA_7 IIGP FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 4735
NCBI-ProteinID: NP_001008491
OMIM: 601506
HGNC: 7729
Ensembl: ENSG00000168385
Vega: OTTHUMG00000133394
Pharos: Q15019(Tbio)
UniProt: Q15019
Structure
PDB: 
2QNR 2QA5 2QAG

Position
2q37.3
AA seq 361 aa
MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLT
DLYPERVIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIIS
YIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPV
IAKADTLTLKERERLKKRILDEIEEHNIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVV
GSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDLHYENFR
SERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGGDGDGGALGHH
V
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtctaagcaacagccaactcagtttataaatccagaaacacctggctatgttggattt
gcaaacctccccaatcaagttcaccgaaaatcagtgaaaaaaggttttgagttcacactg
atggtggtcggtgaatcaggtctaggaaaatcgactctcataaacagcctattcctaact
gatctgtacccagaaagagtcatacctggagcagcagaaaaaattgaaagaactgtccag
attgaggcttcaactgttgaaattgaagagcgaggggtcaagctacgcctgacagtggta
gatacccctggctatggtgacgctatcaactgcagagattgttttaagacaattatctcc
tatattgatgagcaatttgagaggtacctgcatgacgagagcggcttgaacaggcggcac
atcattgataatagggtgcattgttgcttttactttatttcaccttttggacatggactt
aagcccttagatgtggcgtttatgaaggcaatacacaacaaggtgaatattgtgcctgtc
attgcaaaagctgacactctcaccctgaaggaacgggagcggctgaagaaaaggattctg
gatgaaattgaagaacataacatcaaaatctatcacttacctgatgcagaatcagatgaa
gatgaagattttaaagagcagactagacttctcaaggctagcatcccattctctgtggtt
ggatccaatcagttgattgaagccaaaggaaagaaggtcagaggccgcctctacccctgg
ggtgttgtggaagtggagaacccagagcacaatgactttctgaagctgagaaccatgctc
atcacccacatgcaggatctccaggaggtgacccaggaccttcattatgaaaacttccgt
tctgagagactcaagagaggcggcaggaaagtggagaatgaggacatgaataaagaccag
atcttgctggaaaaagaagctgagctccgccgcatgcaagagatgattgcaaggatgcag
gcgcagatgcagatgcagatgcagggcggggatggcgatggcggggctctcgggcaccac
gtgtaa

KEGG   Homo sapiens (human): 55752
Entry
55752             CDS       T01001                                 

Gene name
SEPTIN11, SEPT11
Definition
(RefSeq) septin 11
  KO
K16939  septin 6/8/11
Organism
hsa  Homo sapiens (human)
Pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    55752 (SEPTIN11)
   05100 Bacterial invasion of epithelial cells
    55752 (SEPTIN11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    55752 (SEPTIN11)
   04147 Exosome [BR:hsa04147]
    55752 (SEPTIN11)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 1
     55752 (SEPTIN11)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   55752 (SEPTIN11)
SSDB
Motif
Pfam: Septin MMR_HSR1 AAA_16 AAA_22 Roc Ras DUF3080 AAA_29 AAA_7 Atg14 RsgA_GTPase
Other DBs
NCBI-GeneID: 55752
NCBI-ProteinID: NP_060713
OMIM: 612887
HGNC: 25589
Ensembl: ENSG00000138758
Vega: OTTHUMG00000160854
Pharos: Q9NVA2(Tbio)
UniProt: Q9NVA2 A0A384P5S0
Position
4q21.1
AA seq 429 aa
MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDT
LFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEY
IDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIP
IIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGST
EEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRC
KLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAE
KELHEKFDLLKRTHQEEKKKVEDKKKELEEEVNNFQKKKAAAQLLQSQAQQSGAQQTKKD
KDKKNASFT
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggccgtggccgtggggagaccgtctaatgaagagcttcgaaacttgtctttgtctggc
catgtgggatttgacagcctccctgaccagctggtcaacaagtctacttctcaaggattc
tgtttcaacatcctttgtgttggtgagacaggcattggcaaatccacgttaatggacact
ttgttcaacaccaaatttgaaagtgacccagctactcacaatgaaccaggtgttcggtta
aaagccagaagttatgagcttcaggaaagcaatgtacggctgaagttaaccattgttgac
accgtgggatttggagaccagataaataaagatgacagctataagccgatagtagaatat
attgatgcccagttcgaggcctacctgcaagaggaattgaagattaaacgttctctcttc
aactaccatgacacgaggatccatgcctgcctctactttattgcccctactggacattca
ctaaagtccctggatctggtcaccatgaaaaagctggacagtaaggtgaacatcattcca
ataattgcaaaagctgacaccattgccaagaatgaactgcacaaattcaagagtaagatc
atgagtgaactggtcagcaatggggtccagatatatcagtttcccactgatgaagaaacg
gtggcagagattaacgcaacaatgagtgtccatctcccatttgcagtggttggcagcacc
gaagaggtgaagattggcaacaagatggcaaaggccaggcagtacccctggggtgtggtg
caggttgagaatgaaaatcattgcgattttgtgaaacttcgagagatgctgatccgcgtg
aacatggaggacttgcgagagcagactcacacccgccactatgaattgtaccgacgctgt
aagcttgaagagatggggttcaaggacactgaccctgacagcaaacccttcagtcttcag
gagacatatgaagcaaaaaggaatgaattcctgggagaactgcagaagaaagaagaagaa
atgagacaaatgtttgttatgagagtgaaggagaaagaagctgaacttaaggaggcagag
aaagagcttcacgagaagtttgaccttctaaagcggacacaccaagaagaaaagaagaaa
gtggaagacaagaagaaggagcttgaggaggaggtgaacaacttccagaagaagaaagca
gcggctcagttactacagtcccaggcccagcaatctggggcccagcaaaccaagaaagac
aaggataagaaaaatgcaagcttcacataa

KEGG   Homo sapiens (human): 55964
Entry
55964             CDS       T01001                                 

Gene name
SEPTIN3, SEP3, SEPT3, bK250D10.3
Definition
(RefSeq) septin 3
  KO
K16938  septin 3/9/12
Organism
hsa  Homo sapiens (human)
Pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    55964 (SEPTIN3)
   05100 Bacterial invasion of epithelial cells
    55964 (SEPTIN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    55964 (SEPTIN3)
   04147 Exosome [BR:hsa04147]
    55964 (SEPTIN3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 1
     55964 (SEPTIN3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   55964 (SEPTIN3)
SSDB
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase GTP_EFTU AIG1 Roc Dynamin_N AAA_16 AAA_22 ABC_tran Ras FtsK_SpoIIIE NB-ARC AAA_29 AAA_24 G-alpha P-loop_TraG FeoB_N Sigma54_activat VirE IIGP AAA_32 DUF815 AAA_7
Other DBs
NCBI-GeneID: 55964
NCBI-ProteinID: NP_663786
OMIM: 608314
HGNC: 10750
Ensembl: ENSG00000100167
Vega: OTTHUMG00000030494
Pharos: Q9UH03(Tbio)
UniProt: Q9UH03
Structure
PDB: 
4Z54 4Z51 3SOP

Position
22q13.2
AA seq 358 aa
MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGF
DFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMK
LTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISP
TGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKE
FDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALL
RDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtccaaagggctcccagagaccaggacggacgcagccatgtcagagctggtgcctgag
cccaggcctaagccagcggtgcccatgaagcccatgagcatcaactccaacctgctgggc
tacatcggcatcgacaccatcatcgagcagatgcgcaagaagaccatgaagaccggtttc
gacttcaacatcatggtcgttggccagagtggactgggcaaatcaacgctggtcaacacg
ctcttcaaatcccaagtgagccgcaaggcctccagctggaaccgggaggagaagatcccc
aagacagtggagatcaaagctatcgggcatgtgatagaggaaggcggtgtcaaaatgaag
ctgaccgtcatcgacaccccaggctttggagaccaaatcaacaatgaaaactgctgggag
cccattgagaagtacatcaatgagcagtacgagaagttcctgaaggaggaggtcaacatc
gccaggaagaaacgcatccctgacactcgtgtccactgctgcctttacttcatctctccc
acaggacactccttgcgacctctggatcttgagttcatgaaacacctcagcaaggttgtg
aacatcatccctgtcattgctaaggctgacaccatgaccctggaggagaagtctgaattc
aagcaaagggttcgcaaggagcttgaagtaaatggcattgaattctacccccagaaggaa
tttgatgaggatttggaggataagacggagaatgacaaaatcaggcaggagagcatgcct
tttgctgtggtgggaagtgacaaggagtaccaagtgaatggcaagagggtcctcggccga
aaaactccatgggggatcatcgaagtggaaaacctcaaccactgtgagtttgccctgctt
cgagactttgtcatcaggacccacctccaggacctcaaggaagtgacacacaacatccac
tatgagacttacagggccaagcggctcaatgacaatggaggcctccctccgggagaaggc
ctcctgggcactgtccttccacctgtgccagccaccccctgccccactgctgaatga

DBGET integrated database retrieval system