KEGG   Homo sapiens (human): 10802Help
Entry
10802             CDS       T01001                                 

Gene name
SEC24A
Definition
(RefSeq) SEC24 homolog A, COPII coat complex component
  KO
K14007  protein transport protein SEC24
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00404  COPII complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10802 (SEC24A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10802 (SEC24A)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    10802 (SEC24A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec23_trunk Sec23_helical Sec23_BS zf-Sec23_Sec24 Gelsolin
Motif
Other DBs
NCBI-GeneID: 10802
NCBI-ProteinID: NP_068817
OMIM: 607183
HGNC: 10703
Ensembl: ENSG00000113615
Vega: OTTHUMG00000163064
Pharos: O95486(Tdark)
UniProt: O95486 B4E205
Structure
PDB: 

Position
5q31.1
AA seq 1093 aa AA seqDB search
MSQPGIPASGGAPASLQAQNGAALASGSPYTNGPVQNALLSSQESVSQGYNFQLPGSYPH
PIPAKTLNPVSGQSNYGGSQGSGQTLNRPPVASNPVTPSLHSGPAPRMPLPASQNPATTP
MPSSSFLPEANLPPPLNWQYNYPSTASQTNHCPRASSQPTVSGNTSLTTNHQYVSSGYPS
LQNSFIKSGPSVPPLVNPPLPTTFQPGAPHGPPPAGGPPPVRALTPLTSSYRDVPQPLFN
SAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQ
NTTPPGATGVPPSSLNYPSGPQAFTQTPLGANHLTTSMSGLSLQPEGLRVVNLLQERNML
PSTPLKPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLVQL
PVVTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFLYNPLTRVYGEPHRR
PEVQNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDNLDLLPGNT
RTKIGFITFDSTIHFYGLQESLSQPQMLIVSDIEDVFIPMPENLLVNLNESKELVQDLLK
TLPQMFTKTLETQSALGPALQAAFKLMSPTGGRMSVFQTQLPTLGVGALKPREEPNHRSS
AKDIHMTPSTDFYKKLALDCSGQQVAVDLFLLSGQYSDLASLGCISRYSAGSVYYYPSYH
HQHNPVQVQKLQKELQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVN
PDAGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNDVFLGADV
QAISGLLANMAVDRSMTASLSDARDALVNAVIDSLSAYRSSVLSNQQPGLMVPFSLRLFP
LFVLALLKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLYRVDNLSDEGALNI
SDRTIPQPPILQLSVEKLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNYASIPQP
MTDLPELDTPESARIIAFISWLREQRPFFPILYVIRDESPMKANFLQNMIEDRTESALSY
YEFLLHIQQQVNK
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagccgggaataccggcctccggcggcgccccagccagcctccaggcccagaac
ggagccgccttggcctcggggtctccctacaccaacggtcctgtccaaaatgcattgctg
tcttcacaagagtcagtgagccaaggatacaatttccagcttccaggatcctaccctcat
ccaataccagcaaagactttgaatccagtctctggacagtctaactatggtggttctcag
ggatctgggcagactcttaatagaccacctgtggcctctaatccagtgacaccttcgctt
catagtggtcctgctccccgaatgccattacctgcttctcagaacccagctactacacca
atgccttctagtagctttcttcctgaagccaacctgccaccacctttgaattggcaatat
aactatccatccacagcctcacaaacaaaccattgtcctcgtgcatcatcccaaccaact
gtatctggaaatacaagtttaaccacaaatcatcaatatgtttcttctggatatccttca
cttcaaaatagcttcataaagtcaggtccttctgtacctcccttagtgaatccacctctg
cctacaacttttcaaccaggagctcctcatgggccccctccagctggaggcccaccccca
gtgagggccctcacgcccctgacatcatcatatagagatgtaccccagcccttatttaat
tcagctgtcaaccaagaaggtattacatcaaataccaataacggatctatggtggtccac
agtagttacgacgagattgaaggaggtggcttattggcaacaccacagcttactaacaag
aatcccaaaatgagccgaagtgttggatattcatatccctccttaccacctggttatcag
aacacaacaccacctggtgcaactggagtaccaccctcttccttgaattacccaagtggg
ccacaagcctttactcagactcccttaggtgctaatcatttaaccacaagcatgagtgga
ttaagtctacaaccagagggtctaagagttgtcaatcttcttcaagaaagaaacatgctt
ccgtcaacacctttgaagcctccagttccaaatttgcatgaagacatccagaaactcaac
tgtaacccagagttatttcgatgcacgctgactagcattcctcagacgcaggccttattg
aataaagccaaacttcctttggggctgctgcttcatcctttcaaagacttagtgcaattg
cctgtggttacctccagtacaattgtgagatgccgttcatgcaggacgtacatcaatcct
ttcgtcagctttcttgatcaaaggagatggaagtgtaacttatgttatcgagtcaatgat
gttcctgaagaattcttgtacaaccctttgaccagagtttatggagaacctcacagaaga
ccagaagttcaaaatgctactattgagtttatggctccttcagaatacatgttacgacca
cctcagcctccagtgtatctctttgtatttgatgtgtctcacaatgcagtcgaaactgga
tacttgaattcagtttgccagagtttgttagacaatctggatttgcttcctggcaacact
agaacaaaaattggcttcataacatttgacagtacaatccatttctacggtcttcaggaa
agtctctctcaacctcagatgctaatagtttcagatattgaagatgtttttatacctatg
ccagagaacttattagtaaacttaaatgaaagtaaagagctcgtgcaagatttactgaaa
actttgccacaaatgtttaccaagactctggagacccagagtgccttgggtcctgcactg
caggctgcctttaagctgatgtctccaactggtggtcgaatgtctgtctttcaaacacaa
ctcccaactcttggagtgggagccctgaaaccacgagaggaaccaaaccacaggtcatct
gctaaggatatacacatgacaccatccactgacttctataagaaattagccttggactgt
tctggtcagcaagttgctgttgacttattccttctcagtggacagtattctgatttggct
tctctgggttgtatttctcggtattcagcaggtagtgtctattactatccctcttaccat
catcagcacaacccagtccaagtacagaaattacagaaggaactacagagataccttact
cggaagattggctttgaggcagtcatgaggattcggtgcaccaaaggtctttccattcat
actttccatggaaacttctttgttaggtcaaccgacttactgtctttgcctaacgtcaac
ccagacgctgggtatgcagtacagatgtcagtggaagagagtcttactgacactcagttg
gtttcttttcagtcagcactcttgtatacatccagcaaaggcgaaagaagaattcgtgtt
catactttgtgtttgccagtagtttcgactctgaatgatgtctttcttggagctgatgtt
caagcaatttcagggttattggccaatatggctgttgacagatctatgactgccagtctg
agtgacgctcgggatgctctagtgaatgcagtcattgactccctttcagcttaccgttct
tcagtcttaagtaaccagcagcctggactcatggttcctttttctttgcggcttttccca
ctttttgtgttggctctccttaaacagaaatcattccagactgggacaaatgcacgtcta
gatgaacgcatttttgctatgtgtcaagtgaaaaaccagcccttggtttaccttatgctc
acaactcatcccagtttgtatagagttgacaatctctcagatgagggagcactcaacatc
agtgatagaaccatacctcagccccccattcttcagctttcagtggagaagctgagcaga
gatggagctttcctcatggatgcaggctctgtactgatgctttgggttggaaaaaattgt
acacagaattttctcagccaagttctaggagttcaaaactatgcatcaattccacagcct
atgacagaccttccagaacttgatacaccagaatctgccagaataatagctttcatctct
tggcttagagagcagagaccatttttcccaatactttatgtaataagggatgagagtcca
atgaaagcaaacttccttcaaaacatgatagaagacagaacagaatctgcattatcatat
tatgaattcctgttgcatatacagcaacaagtgaataaatga

DBGET integrated database retrieval system