KEGG   Homo sapiens (human): 10803Help
Entry
10803             CDS       T01001                                 

Gene name
CCR9, CC-CKR-9, CDw199, GPR-9-6, GPR28
Definition
(RefSeq) C-C motif chemokine receptor 9
  KO
K04184  C-C chemokine receptor type 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04672  Intestinal immune network for IgA production
Drug target
Vercirnon (DG01370): D10378 D10379
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10803 (CCR9)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    10803 (CCR9)
   04062 Chemokine signaling pathway
    10803 (CCR9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    10803 (CCR9)
   04050 Cytokine receptors [BR:hsa04050]
    10803 (CCR9)
   04090 CD molecules [BR:hsa04090]
    10803 (CCR9)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    10803 (CCR9)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   10803 (CCR9)
CD molecules [BR:hsa04090]
 Proteins
  10803 (CCR9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF621
Motif
Other DBs
NCBI-GeneID: 10803
NCBI-ProteinID: NP_112477
OMIM: 604738
HGNC: 1610
Ensembl: ENSG00000173585
Vega: OTTHUMG00000133450
Pharos: P51686(Tchem)
UniProt: P51686
Structure
PDB: 

Position
3p21.31
AA seq 369 aa AA seqDB search
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFI
VGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCK
VVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALC
IPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHT
LIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQ
VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL
ETTSGALSL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgacacccacagacttcacaagccctattcctaacatggctgatgactatggctctgaa
tccacatcttccatggaagactacgttaacttcaacttcactgacttctactgtgagaaa
aacaatgtcaggcagtttgcgagccatttcctcccacccttgtactggctcgtgttcatc
gtgggtgccttgggcaacagtcttgttatccttgtctactggtactgcacaagagtgaag
accatgaccgacatgttccttttgaatttggcaattgctgacctcctctttcttgtcact
cttcccttctgggccattgctgctgctgaccagtggaagttccagaccttcatgtgcaag
gtggtcaacagcatgtacaagatgaacttctacagctgtgtgttgctgatcatgtgcatc
agcgtggacaggtacattgccattgcccaggccatgagagcacatacttggagggagaaa
aggcttttgtacagcaaaatggtttgctttaccatctgggtattggcagctgctctctgc
atcccagaaatcttatacagccaaatcaaggaggaatccggcattgctatctgcaccatg
gtttaccctagcgatgagagcaccaaactgaagtcagctgtcttgaccctgaaggtcatt
ctggggttcttccttcccttcgtggtcatggcttgctgctataccatcatcattcacacc
ctgatacaagccaagaagtcttccaagcacaaagccctaaaagtgaccatcactgtcctg
accgtctttgtcttgtctcagtttccctacaactgcattttgttggtgcagaccattgac
gcctatgccatgttcatctccaactgtgccgtttccaccaacattgacatctgcttccag
gtcacccagaccatcgccttcttccacagttgcctgaaccctgttctctatgtttttgtg
ggtgagagattccgccgggatctcgtgaaaaccctgaagaacttgggttgcatcagccag
gcccagtgggtttcatttacaaggagagagggaagcttgaagctgtcgtctatgttgctg
gagacaacctcaggagcactctccctctga

DBGET integrated database retrieval system