KEGG   Homo sapiens (human): 10808
Entry
10808             CDS       T01001                                 

Symbol
HSPH1, HSP105, HSP105A, HSP105B, NY-CO-25
Name
(RefSeq) heat shock protein family H (Hsp110) member 1
  KO
K09485  heat shock protein 110kDa
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10808 (HSPH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10808 (HSPH1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP110
   10808 (HSPH1)
SSDB
Motif
Pfam: HSP70 MreB_Mbl F-box-like_2
Other DBs
NCBI-GeneID: 10808
NCBI-ProteinID: NP_006635
OMIM: 610703
HGNC: 16969
Ensembl: ENSG00000120694
Vega: OTTHUMG00000016685
Pharos: Q92598(Tbio)
UniProt: Q92598 A0A024RDS1
Structure
PDB: 
6GFA

Position
13q12.3
AA seq 858 aa
MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHA
NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM
LLTKLKETAENSLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALN
YGIYKQDLPSLDEKPRIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKL
VEHFCAEFKTKYKLDAKSKIRALLRLYQECEKLKKLMSSNSTDLPLNIECFMNDKDVSGK
MNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAVEIVGGATRIPAVKERIAKFFGK
DISTTLNADEAVARGCALQCAILSPAFKVREFSVTDAVPFPISLIWNHDSEDTEGVHEVF
SRNHAAPFSKVLTFLRRGPFELEAFYSDPQGVPYPEAKIGRFVVQNVSAQKDGEKSRVKV
KVRVNTHGIFTISTASMVEKVPTEENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGT
QPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEA
NLVWQLGKDLLNMYIETEGKMIMQDKLEKERNDAKNAVEEYVYEFRDKLCGPYEKFICEQ
DHQNFLRLLTETEDWLYEEGEDQAKQAYVDKLEELMKIGTPVKVRFQEAEERPKMFEELG
QRLQHYAKIAADFRNKDEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQAKKSLDQDPVV
RAQEIKTKIKELNNTCEPVVTQPKPKIESPKLERTPNGPNIDKKEEDLEDKNNFGAEPPH
QNGECYPNEKNSVNMDLD
NT seq 2577 nt   +upstreamnt  +downstreamnt
atgtcggtggtggggttggacgtgggctcgcagagctgctacatcgcggtagcccgggcc
gggggcatcgagaccatcgccaatgagttcagcgaccggtgcaccccgtcagtcatatca
tttggatcaaaaaatagaacaatcggagttgcagccaaaaatcagcaaatcactcatgca
aacaatacggtgtctaacttcaaaagatttcatggccgagcattcaatgaccccttcatt
caaaaggagaaggaaaacttgagttacgatttggttccattgaaaaatggtggagttgga
ataaaggtaatgtacatgggtgaagaacatctatttagtgtggagcagataacagccatg
ttgttgactaagctgaaggaaactgctgaaaacagcctcaagaaaccagtaacagattgt
gttatttcagtcccctccttctttacagatgctgagaggcgatctgtgttagatgctgca
cagattgttggcctaaactgtttaagacttatgaatgacatgacagctgttgctttgaat
tacggaatttataagcaggatctcccaagcctggatgagaaacctcggatagtggttttt
gttgatatgggacattcagcttttcaagtgtctgcttgtgcttttaacaagggaaaattg
aaggtactgggaacagcttttgatcctttcttaggaggaaaaaacttcgatgaaaagtta
gtggaacatttttgtgcagaatttaaaactaagtacaagttggatgcaaaatccaaaata
cgagcactcctacgtctgtatcaggaatgtgaaaaactgaaaaagctaatgagctctaac
agcacagaccttccactgaatatcgaatgctttatgaatgataaagatgtttccggaaag
atgaacaggtcacaatttgaagaactctgtgctgaacttctgcaaaagatagaagtaccc
ctttattcactgttggaacaaactcatctcaaagtagaagatgtgagtgcagttgagatt
gttggaggcgctacacgaattccagctgtgaaggaaagaattgccaaattctttggaaaa
gatattagcacaacactcaatgcagatgaagcagtagccagaggatgtgcattacagtgt
gcaatactttccccggcatttaaagttagagaattttccgtcacagatgcagttcctttt
ccaatatctctgatctggaaccatgattcagaagatactgaaggtgttcatgaagtcttt
agtcgaaaccatgctgctcctttctccaaagttctcacctttctgagaagggggcctttt
gagctagaagctttctattctgatccccaaggagttccatatccagaagcaaaaataggc
cgctttgtagttcagaatgtttctgcacagaaagatggagaaaaatctagagtaaaagtc
aaagtgcgagtcaacacccatggcattttcaccatctctacggcatctatggtggagaaa
gtcccaactgaggagaatgaaatgtcttctgaagctgacatggagtgtctgaatcagaga
ccaccagaaaacccagacactgataaaaatgtccagcaagacaacagtgaagctggaaca
cagccccaggtacaaactgatgctcaacaaacctcacagtctcccccttcacctgaactt
acctcagaagaaaacaaaatcccagatgctgacaaagcaaatgaaaaaaaagttgaccag
cctccagaagctaaaaagcccaaaataaaggtggtgaatgttgagctgcctattgaagcc
aacttggtctggcagttagggaaagaccttcttaacatgtatattgagacagagggtaag
atgataatgcaagataaattggaaaaagaaaggaatgatgctaaaaatgcagttgaggaa
tatgtgtatgagttcagagacaagctgtgtggaccatatgaaaaatttatatgtgagcag
gatcatcaaaattttttgagactcctcacagaaactgaagactggctgtatgaagaagga
gaggaccaagctaaacaagcatatgttgacaagttggaagaattaatgaaaattggcact
ccagttaaagttcggtttcaggaagctgaagaacggccaaaaatgtttgaagaactagga
cagaggctgcagcattatgccaagatagcagctgacttcagaaataaggatgagaaatac
aaccatattgatgagtctgaaatgaaaaaagtggagaagtctgttaatgaagtgatggaa
tggatgaataatgtcatgaatgctcaggctaaaaagagtcttgatcaggatccagttgta
cgtgctcaggaaattaaaacaaaaatcaaggaattgaacaacacatgtgaacccgttgta
acacaaccgaaaccaaaaattgaatcacccaaactggaaagaactccaaatggcccaaat
attgataaaaaggaagaagatttagaagacaaaaacaattttggtgctgaacctccacat
cagaatggtgaatgttaccctaatgagaaaaattctgttaatatggacttggactag

KEGG   Homo sapiens (human): 22824
Entry
22824             CDS       T01001                                 

Symbol
HSPA4L, APG-1, APG1, HSPH3, Osp94
Name
(RefSeq) heat shock protein family A (Hsp70) member 4 like
  KO
K09485  heat shock protein 110kDa
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    22824 (HSPA4L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    22824 (HSPA4L)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP110
   22824 (HSPA4L)
SSDB
Motif
Pfam: HSP70 MreB_Mbl
Other DBs
NCBI-GeneID: 22824
NCBI-ProteinID: NP_055093
OMIM: 619077
HGNC: 17041
Ensembl: ENSG00000164070
Vega: OTTHUMG00000133302
Pharos: O95757(Tbio)
UniProt: O95757 A0A140VKE7
Position
4q28.1
AA seq 839 aa
MSVVGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNV
RNTIHGFKKLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGM
LLAKLKETSENALKKPVADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALA
YGIYKQDLPPLDEKPRNVVFIDMGHSAYQVLVCAFNKGKLKVLATTFDPYLGGRNFDEAL
VDYFCDEFKTKYKINVKENSRALLRLYQECEKLKKLMSANASDLPLNIECFMNDLDVSSK
MNRAQFEQLCASLLARVEPPLKAVMEQANLQREDISSIEIVGGATRIPAVKEQITKFFLK
DISTTLNADEAVARGCALQCAILSPAFKVREFSITDLVPYSITLRWKTSFEDGSGECEVF
CKNHPAPFSKVITFHKKEPFELEAFYTNLHEVPYPDARIGSFTIQNVFPQSDGDSSKVKV
KVRVNIHGIFSVASASVIEKQNLEGDHSDAPMETETSFKNENKDNMDKMQVDQEEGHQKC
HAEHTPEEEIDHTGAKTKSAVSDKQDRLNQTLKKGKVKSIDLPIQSSLCRQLGQDLLNSY
IENEGKMIMQDKLEKERNDAKNAVEEYVYDFRDRLGTVYEKFITPEDLSKLSAVLEDTEN
WLYEDGEDQPKQVYVDKLQELKKYGQPIQMKYMEHEERPKALNDLGKKIQLVMKVIEAYR
NKDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEIVAKSKELDN
FCNPIIYKPKPKAEVPEDKPKANSEHNGPMDGQSGTETKSDSTKDSSQHTKSSGEMEVD
NT seq 2520 nt   +upstreamnt  +downstreamnt
atgtctgtggttggcattgacctcggctttctcaactgctacattgctgtcgcgagaagt
ggcggcatcgagaccatcgccaatgagtacagcgacaggtgtaccccggcctgtatatca
ttgggatcaagaactcgagccattggaaatgcagcaaagagccagatagtcacgaacgta
agaaatacaattcatggcttcaaaaagcttcatgggcgatcatttgatgatcccattgtg
caaactgaaaggatcaggcttccctatgaactgcagaaaatgcctaatggaagtgcagga
gttaaggtgcggtacttagaggaagagagaccttttgcaattgagcaagttactggaatg
ctgttagccaagcttaaagagacttcagaaaatgctttgaagaaaccagtggctgactgt
gtgatttcaattcctagcttttttactgatgccgagagaagatctgtgatggctgcagcc
caggttgcaggcttaaattgtttaaggttgatgaatgaaactactgcagttgcactggcg
tatggaatttataaacaggatcttcccccattagatgagaaaccaagaaatgtagtattt
attgatatgggacattctgcctatcaggtcttggtttgtgcttttaacaaaggaaaactt
aaagtcttggctactacctttgatccatatttgggtggcaggaactttgatgaggcttta
gtagactacttctgtgatgagttcaagaccaaatataagataaatgtgaaagaaaactct
cgggccttgttgcgtttatatcaggaatgtgaaaaactaaagaagctaatgagtgcaaat
gcatcagatcttccattgaacattgagtgtttcatgaatgaccttgatgtttctagtaaa
atgaacagggctcaatttgaacaactgtgtgcttcccttttggccagggttgaaccacct
ttaaaagcagtaatggaacaagctaacttacaacgtgaagacattagtagtatagaaatt
gtaggaggagcaacacgaattcctgcagtgaaagaacaaatcactaaattctttcttaaa
gacataagtaccacattaaatgctgatgaagctgttgcaagaggatgtgcgttacagtgt
gcgattctctcaccagcatttaaagtgcgtgaattttccataacagaccttgttccctat
tcaatcacattaaggtggaagacctcttttgaagatggaagtggggaatgtgaagttttc
tgtaagaaccatcctgccccattctcaaaagtcattactttccacaagaaggaaccattt
gaactagaagcattttatactaatttacatgaagtgccttatcctgatgcaagaattggg
agcttcactattcagaatgtttttccacagtctgatggtgatagttccaaagtgaaggtt
aaagttcgtgttaacatccatggaatcttcagtgtggctagcgcatcagtaattgagaag
caaaatttggaaggcgatcacagtgatgctccaatggagacagaaacttcatttaaaaat
gaaaacaaagataatatggataaaatgcaggttgatcaagaagaagggcatcaaaaatgt
catgctgaacacactccagaagaggaaattgatcatacaggagccaaaacaaagtcagct
gtctcagacaaacaagaccgattaaatcagacacttaaaaaaggaaaagtcaaaagtatt
gatctaccgatccagagtagcctatgtagacaactaggccaagatcttctcaacagctac
attgaaaatgaggggaagatgatcatgcaagataagttagagaaagaaagaaatgatgct
aagaatgccgttgaagaatatgtatatgattttagagacaggctgggcactgtctatgaa
aaattcatcactccagaagacttgagtaaactgtctgcagtattggaagacacagaaaat
tggctttatgaagacggagaggaccaacctaaacaagtttatgtggataagcttcaagaa
ctaaagaaatacggccagcctattcaaatgaagtacatggagcatgaagagagaccaaaa
gccttaaatgacttgggaaaaaagatccaacttgtcatgaaagtgatagaagcttataga
aacaaggatgaaagatatgatcatctggatcctactgaaatggaaaaggttgaaaaatgt
atcagtgatgccatgagttggctgaatagtaagatgaatgcacagaacaaactaagtctc
actcaagatcctgtggtaaaagtttcagaaatagtagcaaagtcaaaggaactggataat
ttctgtaaccccatcatttacaagcccaaaccaaaagcagaagttcctgaagacaaacca
aaagctaatagtgaacacaatggcccaatggatggacagagtggaactgaaactaaatca
gattcaacaaaagacagctcacagcatactaaatcctctggagagatggaagtggactaa

KEGG   Homo sapiens (human): 23640
Entry
23640             CDS       T01001                                 

Symbol
HSPBP1, FES1
Name
(RefSeq) HSPA (Hsp70) binding protein 1
  KO
K09562  hsp70-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    23640 (HSPBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    23640 (HSPBP1)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Others
   23640 (HSPBP1)
SSDB
Motif
Pfam: Fes1 Arm Rcd1 HEAT_EZ PPTA
Other DBs
NCBI-GeneID: 23640
NCBI-ProteinID: NP_001123578
OMIM: 612939
HGNC: 24989
Ensembl: ENSG00000133265
Vega: OTTHUMG00000180705
Pharos: Q9NZL4(Tbio)
UniProt: Q9NZL4
Structure
PDB: 
1XQR 1XQS

Position
19q13.42
AA seq 359 aa
MSDEGSRGSRLPLALPPASQGCSSGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEP
DPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQER
EGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQ
EQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQ
QQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLV
TDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtcagacgaaggctcaagggggagccgcctgcccctggcgctgcccccggcctcccag
ggttgctcttcagggggcggcggcggcggctcctcggctgggggctcgggcaattcccgg
cccccacgcaacctccaaggcttgctgcagatggccatcaccgcgggctctgaagagcca
gaccctcctccagaaccgatgagtgaggagaggcgtcagtggctgcaggaggccatgtcg
gctgccttccgaggccagcgggaggaggtggagcagatgaagagctgcctccgagtgctg
tcacagcccatgccccccactgctggggaggccgagcaggcggccgaccagcaagagcga
gagggggccctggagctgctggccgacctgtgtgagaacatggacaatgccgcagacttc
tgccagctgtctggcatgcacctgctggtgggccggtacctggaggcgggggctgcggga
ctgcggtggcgggcggcacagctcatcggcacgtgcagtcagaacgtggcagccatccag
gagcaggtgctgggcctgggtgccctgcgtaagctgctgcggctgctggaccgcgacgcc
tgcgacacggtgcgcgtcaaggccctcttcgccatctcctgtctggtccgagagcaggag
gctgggctgctgcagttcctccgcctggacggcttctctgtgttgatgagggccatgcag
cagcaggtgcagaagctcaaggtcaaatcagcattcctgctgcagaacctgctggtgggc
caccctgaacacaaagggaccctgtgctccatggggatggtccagcagctggtggccctg
gtgcggacagagcacagccccttccacgagcacgtgcttggagccctgtgcagcctggtg
acagactttccgcagggtgtgcgcgagtgtcgggagccggaactgggcctggaggagctc
ctccgccaccgctgtcagctgctgcagcagcatgaggagtaccaggaggagctggagttc
tgtgaaaagctgctacagacctgtttctccagcccagcggacgacagcatggatcggtga

KEGG   Homo sapiens (human): 573
Entry
573               CDS       T01001                                 

Symbol
BAG1, BAG-1, HAP, RAP46
Name
(RefSeq) BAG cochaperone 1
  KO
K09555  BCL2-associated athanogene 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    573 (BAG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    573 (BAG1)
   04131 Membrane trafficking [BR:hsa04131]
    573 (BAG1)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  BAG
   573 (BAG1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Co-chaperones
    573 (BAG1)
SSDB
Motif
Pfam: ubiquitin BAG Ubiquitin_5 DUF5082 Ubiquitin_2
Other DBs
NCBI-GeneID: 573
NCBI-ProteinID: NP_004314
OMIM: 601497
HGNC: 937
Ensembl: ENSG00000107262
Vega: OTTHUMG00000019766
Pharos: Q99933(Tbio)
UniProt: Q99933
Structure
PDB: 

Position
9p13.3
AA seq 345 aa
MAQRGGARRPRGDRERLGSRLRALRPGREPRQSEPPAQRGPPPSGRPPARSTASGHDRPT
RGAAAGARRPRMKKKTRRRSTRSEELTRSEELTLSEEATWSEEATQSEEATQGEEMNRSQ
EVTRDEESTRSEEVTREEMAAAGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEV
IGVPQSFQKLIFKGKSLKEMETPLSALGIQDGCRVMLIGKKNSPQEEVELKKLKHLEKSV
EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPEN
FKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE
NT seq 1038 nt   +upstreamnt  +downstreamnt
ctggctcagcgcgggggggcgcggagaccgcgaggcgaccgggagcggctgggttcccgg
ctgcgcgcccttcggccaggccgggagccgcgccagtcggagcccccggcccagcgtggt
ccgcctccctctgggcgtccacctgcccggagtactgccagcgggcatgaccgacccacc
aggggcgccgccgccggcgctcgcaggccgcggatgaagaagaaaacccggcgccgctcg
acccggagcgaggagttgacccggagcgaggagttgaccctgagtgaggaagcgacctgg
agtgaagaggcgacccagagtgaggaggcgacccagggcgaagagatgaatcggagccag
gaggtgacccgggacgaggagtcgacccggagcgaggaggtgaccagggaggaaatggcg
gcagctgggctcaccgtgactgtcacccacagcaatgagaagcacgaccttcatgttacc
tcccagcagggcagcagtgaaccagttgtccaagacctggcccaggttgttgaagaggtc
ataggggttccacagtcttttcagaaactcatatttaagggaaaatctctgaaggaaatg
gaaacaccgttgtcagcacttggaatacaagatggttgccgggtcatgttaattgggaaa
aagaacagtccacaggaagaggttgaactaaagaagttgaaacatttggagaagtctgtg
gagaagatagctgaccagctggaagagttgaataaagagcttactggaatccagcagggt
tttctgcccaaggatttgcaagctgaagctctctgcaaacttgataggagagtaaaagcc
acaatagagcagtttatgaagatcttggaggagattgacacactgatcctgccagaaaat
ttcaaagacagtagattgaaaaggaaaggcttggtaaaaaaggttcaggcattcctagcc
gagtgtgacacagtggagcagaacatctgccaggagactgagcggctgcagtctacaaac
tttgccctggccgagtga

KEGG   Homo sapiens (human): 9532
Entry
9532              CDS       T01001                                 

Symbol
BAG2, BAG-2, dJ417I1.2
Name
(RefSeq) BAG cochaperone 2
  KO
K09556  BCL2-associated athanogene 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9532 (BAG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    9532 (BAG2)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  BAG
   9532 (BAG2)
SSDB
Motif
Pfam: AMP-binding_C_2 ParD_antitoxin NES_C_h
Other DBs
NCBI-GeneID: 9532
NCBI-ProteinID: NP_004273
OMIM: 603882
HGNC: 938
Ensembl: ENSG00000112208
Vega: OTTHUMG00000014919
Pharos: O95816(Tbio)
UniProt: O95816
Position
6p12.1
AA seq 211 aa
MAQAKINAKANEGRFCRSSSMADRSSRLLESLDQLELRVEALREAATAVEQEKEILLEMI
HSIQNSQDMRQISDGEREELNLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEV
VNKFLDDLGNAKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN
IENSDKAIKLLEHSKGAGSKTLQQNAESRFN
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctcaggcgaagatcaacgctaaagccaacgaggggcgcttctgccgctcctcctcc
atggctgaccgctccagccgcctgctggagagcctggaccagctggagctcagggttgaa
gctttgagagaagcagcaactgctgttgagcaagagaaagaaatccttctggaaatgatc
cacagtatccaaaatagccaggacatgaggcagatcagtgacggagaaagagaagaatta
aatctgactgcaaaccgtttgatgggaagaactctcaccgttgaagtgtcagtagaaaca
attagaaacccccagcagcaagaatccctaaagcatgccacaaggattattgatgaggtg
gtcaataagtttctggatgatttgggaaatgccaagagtcatttaatgtcgctctacagt
gcatgttcatctgaggtgccacatgggccagttgatcagaagtttcaatccatagtaatt
ggctgtgctcttgaagatcagaagaaaattaagagaagattagagactctgcttagaaat
attgaaaactctgacaaggccatcaagctattagagcattctaaaggagctggttccaaa
actctgcaacaaaatgctgaaagcagattcaattag

DBGET integrated database retrieval system