KEGG   Homo sapiens (human): 10810
Entry
10810             CDS       T01001                                 

Gene name
WASF3, Brush-1, SCAR3, WAVE3
Definition
(RefSeq) WASP family member 3
  KO
K06083  WAS protein family, member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04666  Fc gamma R-mediated phagocytosis
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05231  Choline metabolism in cancer
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    10810 (WASF3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    10810 (WASF3)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    10810 (WASF3)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10810 (WASF3)
   05132 Salmonella infection
    10810 (WASF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10810 (WASF3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     10810 (WASF3)
SSDB
Motif
Pfam: WH2 ChaB
Other DBs
NCBI-GeneID: 10810
NCBI-ProteinID: NP_006637
OMIM: 605068
HGNC: 12734
Ensembl: ENSG00000132970
Vega: OTTHUMG00000016621
Pharos: Q9UPY6(Tbio)
UniProt: Q9UPY6 Q5T8P4
Position
13q12.13
AA seq 502 aa
MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEAN
NFYIRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMKKAFKSSTVQDQQVVSKNSIPNP
VADIYNQSDKPPPLNILTPYRDDKKDGLKFYTDPSYFFDLWKEKMLQDTEDKRKEKRRQK
EQKRIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGSLSPDTRS
HASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNR
PQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPPVIPSAQTAFV
SPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTAPPPPGPPPPPPGPPGPGSSLSSSPMH
GPPVAEAKRQEPAQPPISDARSDLLAAIRMGIQLKKVQEQREQEAKREPVGNDVATILSR
RIAVEYSDSDDDSEFDENDWSD
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcctttagtgaagaggaacattgagccccggcacttgtgccggggagctctgcctgaa
gggattaccagcgaacttgaatgtgtaaccaatagtactcttgccgctatcatacgccag
ctgagcagtctgagcaaacatgctgaagacatatttggtgagttgtttaatgaggctaac
aacttctacatcagagcaaattctcttcaagacagaattgatcgccttgctgtcaaagtc
acccagctggattcaacagtggaagaggtctcactacaggatatcaacatgaaaaaagct
ttcaaaagttccacagtccaagaccagcaagtggtttcaaagaacagcattcctaatcct
gttgctgatatttacaaccagagtgataagccaccgcctctgaacatcctgacaccatac
agagatgacaagaaggatgggctgaagttctatactgatccttcctatttctttgacctc
tggaaagaaaaaatgctacaggacacagaagacaaaaggaaagagaaaaggcgtcaaaag
gagcaaaagcgtatagatggcaccacccgtgaggtgaaaaaggttagaaaagccagaaac
aggcgccaggagtggaatatgatggcatatgacaaagagcttagacccgacaacaggttg
tctcagagtgtgtaccatggagcgtcttccgagggatccctgtccccagatactaggtca
catgcatcggacgttacggattactcttacccggctactcccaaccattctctgcacccc
cagcctgtgaccccttcctatgcagctggtgacgtgccaccacacgggcctgcaagccag
gctgcggagcatgagtaccggcccccatctgcctcggcgaggcacatggccctcaacaga
cctcagcagccgccccccccgcctccccctcaggccccagaggggtcccaggcctctgca
ccgatggctccagcagactacgggatgctcccagcgcagataattgagtattacaaccca
tccggaccacctcctccgccacctcctcctgtgattccctcagcacaaactgccttcgtc
agccctctccagatgcccatgcagcccccgttccctgcatcagccagctccacgcacgca
gctcctcctcacccaccctccaccgggctcctggtcacagccccgccacccccgggccca
ccacctcccccgccaggccctcctggtcccgggtcttctctttcgtcctccccaatgcat
ggccccccagtagctgaggcgaagcggcaagagcctgcacagccaccaatcagtgatgct
cgaagcgacctcctcgctgctattcgaatgggaattcaactgaaaaaggtgcaggagcag
cgggagcaggaggccaagcgggagccagtggggaatgacgtggccacgatcctgtcccgg
cgcattgccgtggagtacagcgactctgacgacgactcagagttcgacgagaacgactgg
tccgactga

DBGET integrated database retrieval system