KEGG   Homo sapiens (human): 10811Help
Entry
10811             CDS       T01001                                 

Gene name
NOXA1, NY-CO-31, SDCCAG31, p51NOX
Definition
(RefSeq) NADPH oxidase activator 1
  KO
K21432  NADPH oxidase activator 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10811 (NOXA1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    10811 (NOXA1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    10811 (NOXA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_1 TPR_2 PB1 TPR_1 TPR_7 SH3_9 SH3_2 TPR_9 TPR_8 TPR_4
Motif
Other DBs
NCBI-GeneID: 10811
NCBI-ProteinID: NP_001242996
OMIM: 611255
HGNC: 10668
Ensembl: ENSG00000188747
Vega: OTTHUMG00000131781
Pharos: Q86UR1(Tbio)
UniProt: Q86UR1
Position
9q34.3
AA seq 476 aa AA seqDB search
MASLGDLVRAWHLGAQAVDRGDWARALHLFSGVPAPPARLCFNAGCVHLLAGDPEAALRA
FDQAVTKDTCMAVGFFQRGVANFQLARFQEALSDFWLALEQLRGHAAIDYTQLGLRFKLQ
AWEVLHNVASAQCQLGLWTEAASSLREAMSKWPEGSLNGLDSALDQVQRRGSLPPRQVPR
GEVFRPHRWHLKHLEPVDFLGKAKVVASAIPDDQGWGVRPQQPQGPGANHDARSLIMDSP
RAGTHQGPLDAETEVGADRCTSTAYQEQRPQVEQVGKQAPLSPGLPAMGGPGPGPCEDPA
GAGGAGAGGSEPLVTVTVQCAFTVALRARRGADLSSLRALLGQALPHQAQLGQLSYLAPG
EDGHWVPIPEEESLQRAWQDAAACPRGLQLQCRGAGGRPVLYQVVAQHSYSAQGPEDLGF
RQGDTVDVLCEVDQAWLEGHCDGRIGIFPKCFVVPAGPRMSGAPGRLPRSQQGDQP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcctctctgggggacctggtgcgcgcctggcacctgggcgcgcaggctgtggatcgt
ggggactgggcccgcgccttgcacctcttctcgggcgtcccggcgccgcccgccaggctg
tgcttcaacgcgggctgcgtgcacctgctggccggggaccccgaggccgcgctgcgggca
tttgaccaagccgtgaccaaggacacctgcatggcggttggcttcttccagcgaggagtg
gccaacttccagctggcaaggttccaggaggctctgtctgacttctggctggccctggag
cagctgaggggccacgctgccatcgactacacgcagctgggcctgcggttcaagctgcaa
gcctgggaggtgctacacaatgtggcgtcggcacagtgccagctggggctctggacagag
gcggccagcagcctaagggaggccatgtccaagtggccggaggggtccctgaatggcctg
gactcagccctggaccaagtgcagagacggggctcactgccgccacggcaggtccccagg
ggcgaggtcttccggccccaccggtggcacctgaagcacttggagcccgtggatttcctg
ggcaaggccaaggtggtggcctctgccatccccgacgaccagggctggggcgtccgccct
cagcagccacagggaccaggagcgaaccatgatgccaggtccctaatcatggactcccca
agagctggcacccaccagggccccctcgatgcagagacagaggtcggtgctgaccgctgc
acgtcgactgcctaccaggagcagaggccccaggtggagcaagttggcaaacaggctcct
ctctccccagggctgccggcaatgggggggcctggccccggcccctgtgaggaccccgcg
ggtgctgggggagcaggtgcagggggctccgagcccctggtgactgtcaccgtgcagtgc
gccttcacagtggccctgagggcacgaagaggagccgacctgtccagcctgcgggcactg
ctgggccaagccctccctcaccaggcccagcttgggcaactcagttacctagccccaggt
gaggacgggcactgggtccccatccccgaggaggagtcgctgcagagggcctggcaggac
gcagctgcctgccccagggggctgcagctgcagtgcaggggagccgggggtcggccggtc
ctctaccaggtggtggcccagcacagctactccgcccaggggccagaggacctgggcttc
cgacagggggacacggtggacgtcctgtgtgaagtggaccaggcatggctggagggccac
tgtgacggccgcatcggcatcttccccaagtgcttcgtggtccccgccggccctcggatg
tcaggagcccccggccgcctgccccgatcccagcagggagatcagccctaa

DBGET integrated database retrieval system