KEGG   Homo sapiens (human): 10814Help
Entry
10814             CDS       T01001                                 

Gene name
CPLX2, 921-L, CPX-2, CPX2, Hfb1
Definition
(RefSeq) complexin 2
  KO
K15294  complexin-1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    10814 (CPLX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10814 (CPLX2)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    10814 (CPLX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synaphin LD_cluster2 Spt5_N RR_TM4-6
Motif
Other DBs
NCBI-GeneID: 10814
NCBI-ProteinID: NP_001008221
OMIM: 605033
HGNC: 2310
Ensembl: ENSG00000145920
Vega: OTTHUMG00000130665
Pharos: Q6PUV4(Tbio)
UniProt: Q6PUV4
Position
5q35.2
AA seq 134 aa AA seqDB search
MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE
KVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTV
LKYLPGPLQDMFKK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgtcatgaagcaggcccttggaggggccacaaaggacatggggaagatgctg
gggggagaggaggagaaggaccccgacgcgcagaaaaaggaggaggagcggcaggaggcg
ctgcggcagcaggaggaggagcgtaaggccaagcacgcgcgcatggaggcggagcgggag
aaggtccggcagcagatccgagataagtatgggctgaagaagaaggaggagaaggaagca
gaggagaaagcagccctggagcagccctgcgaggggagcctgacccggcccaagaaggcc
atccctgcgggctgcggggacgaggaggaggaggaagaggagagcatcctggacacggtg
ctcaaatacctgcccgggccgctgcaggacatgttcaagaagtaa

DBGET integrated database retrieval system