KEGG   Homo sapiens (human): 10814
Entry
10814             CDS       T01001                                 

Gene name
CPLX2, 921-L, CPX-2, CPX2, Hfb1
Definition
(RefSeq) complexin 2
  KO
K15294  complexin-1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    10814 (CPLX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10814 (CPLX2)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    10814 (CPLX2)
SSDB
Motif
Pfam: Synaphin Spt5_N
Other DBs
NCBI-GeneID: 10814
NCBI-ProteinID: NP_001008221
OMIM: 605033
HGNC: 2310
Ensembl: ENSG00000145920
Vega: OTTHUMG00000130665
Pharos: Q6PUV4(Tbio)
UniProt: Q6PUV4
Position
5q35.2
AA seq 134 aa
MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE
KVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTV
LKYLPGPLQDMFKK
NT seq 405 nt   +upstreamnt  +downstreamnt
atggacttcgtcatgaagcaggcccttggaggggccacaaaggacatggggaagatgctg
gggggagaggaggagaaggaccccgacgcgcagaaaaaggaggaggagcggcaggaggcg
ctgcggcagcaggaggaggagcgtaaggccaagcacgcgcgcatggaggcggagcgggag
aaggtccggcagcagatccgagataagtatgggctgaagaagaaggaggagaaggaagca
gaggagaaagcagccctggagcagccctgcgaggggagcctgacccggcccaagaaggcc
atccctgcgggctgcggggacgaggaggaggaggaagaggagagcatcctggacacggtg
ctcaaatacctgcccgggccgctgcaggacatgttcaagaagtaa

KEGG   Homo sapiens (human): 10815
Entry
10815             CDS       T01001                                 

Gene name
CPLX1, CPX-I, CPX1, EIEE63
Definition
(RefSeq) complexin 1
  KO
K15294  complexin-1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Disease
H00606  Early infantile epileptic encephalopathy
H01773  4p deletion syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    10815 (CPLX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10815 (CPLX1)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    10815 (CPLX1)
SSDB
Motif
Pfam: Synaphin
Other DBs
NCBI-GeneID: 10815
NCBI-ProteinID: NP_006642
OMIM: 605032
HGNC: 2309
Ensembl: ENSG00000168993
Vega: OTTHUMG00000160005
Pharos: O14810(Tbio)
UniProt: O14810
Position
4p16.3
AA seq 134 aa
MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAERE
AVRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEVEEEDESILDTV
IKYLPGPLQDMLKK
NT seq 405 nt   +upstreamnt  +downstreamnt
atggagtttgtgatgaagcaggctctaggaggggccaccaaggacatggggaagatgctg
gggggtgacgaggagaaggacccagacgccgccaagaaggaggaggagcggcaggaggcg
ctgcgccaggcggaggaggagcgcaaggccaagtacgccaagatggaggcggagcgcgag
gccgtgcgccagggcatccgagacaagtacggcatcaagaagaaggaggagcgcgaggcc
gaggcccaggccgccatggaggccaactccgaggggagcttgacgcggcccaagaaggcc
atcccgccgggctgcggggacgaggtggaggaggaggacgagagcatcctggacaccgtc
atcaagtacctgcccgggccgctgcaggacatgctcaagaagtag

KEGG   Homo sapiens (human): 339302
Entry
339302            CDS       T01001                                 

Gene name
CPLX4, CPX-IV, CPXIV
Definition
(RefSeq) complexin 4
  KO
K15295  complexin-3/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    339302 (CPLX4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    339302 (CPLX4)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    339302 (CPLX4)
SSDB
Motif
Pfam: Synaphin
Other DBs
NCBI-GeneID: 339302
NCBI-ProteinID: NP_857637
OMIM: 609586
HGNC: 24330
Ensembl: ENSG00000166569
Vega: OTTHUMG00000132756
Pharos: Q7Z7G2(Tdark)
UniProt: Q7Z7G2
Position
18q21.32
AA seq 160 aa
MAFLMKSMISNQVKNLGFGGGSEENKEEGGASDPAAAQGMTREEYEEYQKQMIEEKMERD
AAFTQKKAERACLRVHLREKYRLPKSEMDENQIQMAGDDVDLPEDLRKMVDEDQEEEEDK
DSILGQIQNLQNMDLDTIKEKAQATFTEIKQTAEQKCSVM
NT seq 483 nt   +upstreamnt  +downstreamnt
atggctttccttatgaaaagtatgataagtaaccaggtaaagaatttaggatttggtggt
gggtctgaagaaaataaagaagaaggaggtgcatctgatcctgcagcagctcaagggatg
actagagaggagtatgaggagtatcaaaagcaaatgattgaggagaagatggaaagagat
gctgcatttacacagaaaaaggcagaaagggcatgcctcagagttcatctcagagaaaaa
tacaggctcccaaagagtgaaatggatgagaatcaaatccagatggctggagatgatgtg
gatttacctgaagatctccggaaaatggtagatgaagatcaagaagaggaagaagataaa
gattctattcttgggcagatacagaatctccagaacatggacttggataccataaaagaa
aaagcccaggccaccttcactgaaatcaagcagacagcggagcagaagtgttccgtgatg
tga

KEGG   Homo sapiens (human): 594855
Entry
594855            CDS       T01001                                 

Gene name
CPLX3, CPX-III, CPXIII, Nbla11589
Definition
(RefSeq) complexin 3
  KO
K15295  complexin-3/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    594855 (CPLX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    594855 (CPLX3)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    594855 (CPLX3)
SSDB
Motif
Pfam: Synaphin Complex1_LYR
Other DBs
NCBI-GeneID: 594855
NCBI-ProteinID: NP_001025176
OMIM: 609585
HGNC: 27652
Ensembl: ENSG00000213578
Vega: OTTHUMG00000142816
Pharos: Q8WVH0(Tbio)
UniProt: Q8WVH0 A0A384N6F4
Position
15q24.1
AA seq 158 aa
MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDA
QFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKA
SVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEKCHVM
NT seq 477 nt   +upstreamnt  +downstreamnt
atggcgttcatggtgaagaccatggtgggcggccagctgaagaacctcactgggagcctg
ggaggcggcgaggataagggagatggggacaagtcggcagccgaagctcagggcatgagc
cgggaggagtacgaggagtatcagaagcaactcgtggaagagaagatggagcgggatgca
cagttcacacagaggaaggcagagcgggccacactgcggagccacttccgagacaaatac
cggctacccaagaacgagacagatgagagccagatccagatggcaggtggagacgtggag
ctgccccgggagctggccaagatgatcgaggaggacacagaggaggaggaggagaaggcc
tcagtccttgggcagctggccagccttcctggcttgaacctgggctcactcaaggacaag
gcccaggccacactgggggatctcaagcaatcagctgagaagtgtcacgtcatgtga

DBGET integrated database retrieval system