KEGG   Homo sapiens (human): 10817Help
Entry
10817             CDS       T01001                                 

Gene name
FRS3, FRS2-beta, FRS2B, FRS2beta, SNT-2, SNT2
Definition
(RefSeq) fibroblast growth factor receptor substrate 3
  KO
K24039   
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: IRS
Motif
Other DBs
NCBI-GeneID: 10817
NCBI-ProteinID: NP_006644
OMIM: 607744
HGNC: 16970
Ensembl: ENSG00000137218
Vega: OTTHUMG00000014686
Pharos: O43559(Tbio)
UniProt: O43559 A0A140VJJ7
Structure
PDB: 

Position
6p21.1
AA seq 492 aa AA seqDB search
MGSCCSCLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIIT
RNSHPAELDLPRAPQPPNALGYTVSSFSNGCPGEGPRFSAPRRLSTSSLRHPSLGEESTH
ALIAPDEQSHTYVNTPASEDDHRRGRHCLQPLPEGQAPFLPQARGPDQRDPQVFLQPGQV
KFVLGPTPARRHMVKCQGLCPSLHDPPHHNNNNEAPSECPAQPKCTYENVTGGLWRGAGW
RLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSRDGLTPSSNGF
PDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPGPEPPRQLNYIQV
ELKGWGGDRPKGPQNPSSPQAPMPTTHPARSSDSYAVIDLKKTVAMSNLQRALPRDDGTA
RKTRHNSTDLPL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggggagctgctgcagctgcctgaacagagacagcgttccagacaaccaccccaccaag
ttcaaggtgacaaatgtggatgatgagggggtggagctgggctctggggtgatggagctg
acgcagagtgagctggtgctgcacctgcatcggcgtgaggccgtccgctggccttatctc
tgcttgcggcgctatggctacgactccaacctcttctcctttgagagtggccgccgatgt
cagacaggccagggaatatttgcatttaagtgttcccgggctgaggaaatcttcaacctc
cttcaggatctgatgcagtgcaacagcatcaatgtgatggaagagcctgtcatcatcacc
cgcaatagccaccccgctgagcttgacctccctcgagccccccagccacccaatgctcta
ggctacactgtctccagcttttccaatggctgccctggagagggcccacgattctcagct
ccccggcggctctcgacaagcagcctgcggcacccctcgcttggggaagagtccacccat
gccctcattgctcctgatgagcagtcccacacctatgtcaacacaccggccagtgaagat
gaccaccgcaggggccgccactgcctgcagcccctgcctgagggtcaggcacccttcctc
ccgcaggcccggggacctgaccaacgggacccacaggtgttcttgcagccaggccaggtg
aagtttgtgttgggcccgacccctgctcggcggcacatggtgaagtgccagggcctctgt
cccagcctgcatgaccccccacaccacaataataacaatgaggccccttctgagtgtcca
gcccagcccaagtgcacctacgagaacgtcaccggggggctgtggcgaggggctggctgg
agactgagcccagaggagccgggctggaatggccttgcccaccgccgggccgccctgctg
cactatgagaacctgcccccactgccccctgtgtgggaaagccaagcccagcagctggga
ggggaggctggggatgatggggactcgagggatgggctcacaccctcttccaatggcttc
cctgatggtgaggaggacgagaccccactgcagaagcccaccagcacccgggccgccatc
cgcagccacggcagctttcctgtgccactgacccgccgccgcggctccccaagggtcttc
aactttgatttccgccggccggggcccgagcccccaaggcagcttaactacatccaggtg
gagctaaagggctggggtggagaccgccctaaggggccccagaacccctcgagcccccaa
gcccccatgcccaccacccaccctgcccgaagctcagactcctacgccgtgattgacctc
aaaaagaccgtggccatgtccaacctgcagagagctctgccccgagacgatggcaccgcc
aggaaaacccggcacaacagcaccgacctgcctctgtag

DBGET integrated database retrieval system