KEGG   Homo sapiens (human): 10818Help
Entry
10818             CDS       T01001                                 

Gene name
FRS2, FRS1A, FRS2A, FRS2alpha, SNT, SNT-1, SNT1
Definition
(RefSeq) fibroblast growth factor receptor substrate 2
  KO
K12461  fibroblast growth factor receptor substrate 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    10818 (FRS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    10818 (FRS2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    10818 (FRS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS
Motif
Other DBs
NCBI-GeneID: 10818
NCBI-ProteinID: NP_001036020
OMIM: 607743
HGNC: 16971
Ensembl: ENSG00000166225
Vega: OTTHUMG00000169373
Pharos: Q8WU20(Tbio)
UniProt: Q8WU20 L7RTG7
Structure
PDB: 

Position
12q15
AA seq 508 aa AA seqDB search
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVER
NNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDP
QILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSGANNTEWDTGYDSDERRDAPS
VNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTA
AMSNLQKALPRDDGTSRKTRHNSTDLPM
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgggtagctgttgtagctgtccagataaagacactgtcccagataaccatcggaacaag
tttaaggtcattaatgtggatgatgatgggaatgagttaggttctggcataatggaactt
acagacacagaactgattttatacacccgcaaacgtgactcagtaaaatggcactacctc
tgcctgcgacgctatggctatgactcgaatctcttttcttttgaaagtggtcgaaggtgt
caaactggacaaggaatctttgcctttaagtgtgcccgtgcagaagaattatttaacatg
ttgcaagagattatgcaaaataatagtataaatgtggtggaagagccagttgtagaaaga
aataatcatcagacagaattggaagtccctagaacacctcgaacacctacaactccagga
tttgctgctcagaacttacctaatggatatccccgatatccctcatttggagatgcttca
tcccatccgtcaagcagacatccttctgtgggaagtgctcgcctgccttcagtaggggaa
gaatctacacatcctttgcttgtggctgaggaacaagtacatacctatgtcaacactaca
ggtgtgcaagaagagcggaaaaaccgcacaagtgtgcatgttccattggaggcgagggtt
tctaacgctgaaagcagcacaccaaaagaagaaccaagtagtattgaggacagggatcct
cagattcttcttgaacctgaaggagtcaaatttgttttagggccaacccctgttcaaaag
cagttaatggaaaaagagaaactggagcaacttggaagagatcaagttagtggaagtgga
gcaaataacacagaatgggacactggctatgacagtgatgaacgaagagatgcaccctct
gttaacaaactggtgtatgaaaatataaatgggctatctatccctagtgcctcaggggtc
aggagaggtcgtctgacatccaccagtacctcagatacccagaatatcaacaactcagct
cagagaagaactgcattattaaactatgaaaatctaccatctttgcctcctgtttgggaa
gcccgcaagctaagtagggatgaagatgacaatttaggaccaaagaccccatctctaaat
ggctaccataataatctagatccaatgcataactatgtaaatacagagaatgtaacagtg
ccagcaagtgctcacaaaatagaatattcaaggcgtcgggactgtacaccaacagtcttt
aactttgatatcagacgcccaagtttagaacacaggcagcttaattacatacaggttgac
ttggaaggtggcagtgactctgacaaccctcagactccaaaaacgcctacaactcccctt
ccacaaacccctaccaggcgcacagagctgtatgccgtgatagacatcgagagaactgct
gctatgtcaaatttgcagaaagcactgccacgagatgatggtacatctaggaaaactaga
cacaatagtactgatctgcccatgtga

DBGET integrated database retrieval system