KEGG   Homo sapiens (human): 1082
Entry
1082              CDS       T01001                                 
Symbol
CGB3, CGB, CGB5, CGB7, CGB8, LHB, hCGB
Name
(RefSeq) chorionic gonadotropin subunit beta 3
  KO
K10045  chorionic gonadotropin, beta polypeptide
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    1082 (CGB3)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 1082
NCBI-ProteinID: NP_000728
OMIM: 118860
HGNC: 1886
Ensembl: ENSG00000104827
CPD: C18185
UniProt: P0DN86 A0A0F7RQP8
Structure
Position
19:complement(49022869..49024333)
AA seq 165 aa
MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPT
MTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDC
GGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
NT seq 498 nt   +upstreamnt  +downstreamnt
atggagatgttccaggggctgctgctgttgctgctgctgagcatgggcgggacatgggca
tccaaggagccgcttcggccacggtgccgccccatcaatgccaccctggctgtggagaag
gagggctgccccgtgtgcatcaccgtcaacaccaccatctgtgccggctactgccccacc
atgacccgcgtgctgcagggggtcctgccggccctgcctcaggtggtgtgcaactaccgc
gatgtgcgcttcgagtccatccggctccctggctgcccgcgcggcgtgaaccccgtggtc
tcctacgccgtggctctcagctgtcaatgtgcactctgccgccgcagcaccactgactgc
gggggtcccaaggaccaccccttgacctgtgatgacccccgcttccaggactcctcttcc
tcaaaggcccctccccccagccttccaagcccatcccgactcccggggccctcggacacc
ccgatcctcccacaataa

DBGET integrated database retrieval system