KEGG   Homo sapiens (human): 10826
Entry
10826             CDS       T01001                                 
Symbol
FAXDC2, C5orf4
Name
(RefSeq) fatty acid hydroxylase domain containing 2
  KO
K22282  fatty acid hydroxylase domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99983 Lipid metabolism
    10826 (FAXDC2)
SSDB
Motif
Pfam: FA_hydroxylase Exportin-5
Other DBs
NCBI-GeneID: 10826
NCBI-ProteinID: NP_115761
OMIM: 619853
HGNC: 1334
Ensembl: ENSG00000170271
Pharos: Q96IV6(Tdark)
UniProt: Q96IV6
Position
5:complement(154818492..154850603)
AA seq 333 aa
MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFW
QAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKN
EPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTL
IEEVLFYYSHRLLHHPTFYKKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPLVM
GSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTD
TMFKQTKAYERHVLLLGFTPLSESIPDSPKRME
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaaaggagaagctggacatatgctacacaatgaaaagtcaaagcaggagggacacatc
tggggctctatgaggaggacagctttcatcctgggctctggacttctctcatttgtggcc
ttctggaactcagtgacatggcatcttcagagattttggggtgcttctggctacttttgg
caagcccagtgggagaggctgctgactacatttgaagggaaggagtggatcctcttcttt
ataggtgccatccaagtgccttgtctcttcttctggagcttcaatgggcttctattggtg
gttgacacaacaggaaaacctaacttcatctctcgctaccgaattcaggtcggcaagaat
gaacctgtggatcctgtgaaactgcgccagtctatccgcacagttcttttcaaccagtgc
atgatatctttccccatggtggtcttcctctatcccttcctcaaatggtggagagacccc
tgccgccgtgagctacccaccttccactggttcctcctggagctggccatcttcacgctg
atcgaggaagtcttgttctactattcacaccggctccttcaccacccaacattctacaag
aaaatccacaagaaacaccatgagtggacagctcccattggcgtgatctctctctatgcc
caccctatagagcatgcagtctccaacatgctaccggtgatagtgggcccattagtaatg
ggctcccacttgtcctccatcaccatgtggttttccttggccctcatcatcaccaccatc
tcccactgtggctaccaccttcccttcctgccttcgcctgaattccacgactaccaccat
ctcaagttcaaccagtgctatggggtgctgggtgtgctggaccacctccatgggactgac
accatgttcaagcagaccaaggcctacgagagacatgtcctcctgctgggcttcaccccg
ctctctgagagcatcccagactccccaaagaggatggagtga

DBGET integrated database retrieval system