KEGG   Homo sapiens (human): 10842Help
Entry
10842             CDS       T01001                                 

Gene name
PPP1R17, C7orf16, GSBS
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 17
  KO
K08067  protein phosphatase 1 regulatory subunit 17
Organism
hsa  Homo sapiens (human)
Pathway
hsa04730  Long-term depression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    10842 (PPP1R17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    10842 (PPP1R17)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10842 (PPP1R17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 10842
NCBI-ProteinID: NP_006649
OMIM: 604088
HGNC: 16973
Ensembl: ENSG00000106341
Vega: OTTHUMG00000128629
Pharos: O96001(Tbio)
UniProt: O96001 A0A090N8N7
Position
7p14.3
AA seq 155 aa AA seqDB search
MMSTEQMQPLELSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQ
KKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTP
ALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAI
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccactgagcaaatgcagccactggaactctcagaagacagactggacaagcta
gaccctcgttgcagccacttagatgatctttcagaccagttcattaaggactgtgatctc
aaaaagaagcctagaaagggaaaaaatgtacaggccaccctgaatgttgagtcagaccaa
aaaaaaccaaggaggaaagatacaccggcgctgcacatcccacctttcataccaggtgtg
ttttcagaacatttaattaaaagatacgatgttcaagagagacatccaaagggcaaaatg
atccctgttcttcataacactgacctggaacagaaaaagccaaggagaaaagacacacct
gccctgcacatgtccccctttgcagcaggtgtgacattgctcagggacgagagacccaaa
gcaatcgtggaagatgacgaaaaggatggtgacaagatagctatttaa

DBGET integrated database retrieval system